KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0141200-01Help
Entry
Os03t0141200-01   CDS       T02163                                 

Gene name
Os03g0141200
Definition
Similar to Beta-amylase PCT-BMYI (EC 3.2.1.2).
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os03t0141200-01 (Os03g0141200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     Os03t0141200-01 (Os03g0141200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(2273221..2273777,2274704..2274914,2275005..2275115,2275233..2276027)
AA seq 557 aa AA seqDB search
MMSLNLAHQTGAAAAVAPAAPRTAVVAAAAGTVSAPAVAPAAAPSLQLQTQTVDPAAPAQ
GPDLPMAFQALVESLPEEQHPDVGGEERRKVGVPVYVMMPLDTVRKDGNGLNRRKAVEAS
LKALKSAGAEGIMVDVWWGIAECEGPGRYNFTGYMELMEMAKKNGLKVQAVMSFHQCGGN
VGDSVTIPLPKWVLEEMDKDQDLAYTDRSGRRNYEYLSLGADAMPVLKGRTPVQCYGDFM
RAFRDHFAAFMGNTIVEIQVGMGPAGELRYPSYPESNGTWRFPGIGEFQCYDRYMLSSLK
AAAEAVGKPEWGNAGPGDSGGYNDWPEDSPFFRREGGWNTPYGEFFMSWYSQMLLEHGER
ILSAASGVYTGTPGVKISVKVAGIHWHYGTRSHAAELTAGYYNTRHHDGYQPIARMLARH
GAVLNFTCVEMRNHEQPQDAQCRPEELVQQVAAAARESGVGLAGENALPRYDETAHDQIV
TTAAEKAEEERMVAFTYLRMGPDLFQPDNWRRFAAFVKRMTESGVRDVCREQVEREAQGV
AHATGSLVHEAAVALSN
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgctcaacctggctcaccagaccggagcggcggccgccgtggcaccggcggcg
ccacgtacggccgtggtcgcggcggctgcgggtacagtgtctgctccggcggtcgcgccg
gcggcggcgccgagcctgcagctgcagacgcagactgtggacccggcggcgccggcgcag
gggccggacctccccatggccttccaggcgctggtcgagagcctgccggaggagcagcac
ccggacgtgggcggcgaggagcggcgcaaggtgggcgtgccggtgtacgtgatgatgccg
ctggacacggtgcgcaaggacggcaacgggctgaaccggcggaaggcggtggaggcgtcc
ctgaaggcgctgaagagcgccggcgccgaggggatcatggtggacgtgtggtggggcatc
gccgagtgcgagggccccggccgctacaacttcaccgggtacatggagctcatggagatg
gccaagaagaacgggctcaaggtgcaggccgtcatgtcgttccaccagtgtggcggcaac
gtcggcgactcagtcactataccacttccgaaatgggtgttggaggagatggacaaggac
caggacctggcctacacggatcggagcggccgccgcaactacgaatacctctcgctcggc
gccgacgccatgccggtgctcaagggccgcacgccggtgcagtgctacggcgacttcatg
cgcgccttccgcgaccacttcgccgccttcatgggcaacaccatagtcgagattcaagtc
ggcatgggtccggccggtgagctccgctacccgtcgtacccggagagcaatggcacctgg
agattccccggcatcggcgagttccagtgctatgacaggtacatgctgagcagtctcaag
gcggcggcggaggcggtgggcaagccggagtggggcaacgccgggccgggagactccggc
gggtacaacgactggccggaggactcgcccttcttccgccgtgaaggtgggtggaacact
ccctacggtgagtttttcatgagctggtactcgcagatgctcctggaacacggcgagcgc
atcctgtcggcggcgtcgggcgtgtacaccggcacacccggcgtgaagatctccgtgaag
gtggccggcatccactggcactacggcacgcggtcccacgccgcggagctgacggcaggg
tactacaacacgaggcaccacgacgggtaccagccgatcgcgcgcatgctggcccgccac
ggcgcggtgctcaacttcacgtgcgtggagatgcgcaaccacgagcagccgcaggacgcg
cagtgccggcccgaggagctggtgcagcaggtggcggccgcggcgcgggagtccggcgtg
gggctcgccggcgagaacgcgctgccgaggtacgacgagacggcgcacgaccagatcgtg
acgacggcggcggagaaggcggaggaggagcgcatggtagcgttcacctacctgcgcatg
gggcccgacctgttccagccggacaactggcgccgcttcgccgcgttcgtgaagcgcatg
acggagtccggcgtgcgggacgtgtgccgcgagcaggtggagcgggaggcgcagggcgtc
gcgcacgccaccgggtcgctcgtgcacgaggccgccgtcgcgctcagcaactga

DBGET integrated database retrieval system