KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0161800-01Help
Entry
Os03t0161800-01   CDS       T02163                                 

Gene name
Os03g0161800, SUBMERGENCE-INDUCED_PROTEIN_2A, SIP2A
Definition
Similar to SIPL.
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Os03t0161800-01 (Os03g0161800)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Os03t0161800-01 (Os03g0161800)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Os03t0161800-01 (Os03g0161800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr03:join(3338411..3338428,3339370..3339481,3339602..3339696,3339770..3339884,3340004..3340128,3340358..3340428,3340521..3340581)
AA seq 198 aa AA seqDB search
MENQFQDGKEEVIEAWYMDDSEEDQRLPHHREPKEFIPLSKLSELGILSWRLNADDWEND
ENLKKIREARGYSYMDICDVCPEKLPNYEAKLKNFFEEHLHTDEEIRYCLEGSGYFDVRD
QNDQWIRVAVKKGGMIVLPAGMYHRFTLDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARK
EYVEKIINRGGTQAVEAR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccagttccaggatggcaaggaggaggtcatcgaagcttggtacatggatgac
agtgaagaggaccagaggcttcctcatcatcgtgagcccaaagaattcattcctcttagc
aaactttcagagttaggaatattaagctggcgcctgaatgctgatgactgggagaatgat
gagaacctcaagaaaatccgtgaggccaggggatactcttacatggatatttgtgatgtg
tgtccagaaaagctgccaaactatgaggctaagctgaaaaatttctttgaagaacacttg
catactgatgaagagatacgctattgtcttgagggaagtggatacttcgatgtcagggac
caaaatgatcagtggatccgtgtagcagtgaagaaagggggcatgattgttttgcctgcg
ggaatgtatcaccgcttcacattggacagtgacaactacatcaaggcaatgcggctcttt
gtgggagagcctgtctggacgccgtacaaccgtccccatgaccatctgccagctagaaag
gagtatgtcgaaaaaattatcaacaggggtggaactcaagctgtcgaagctcgttaa

DBGET integrated database retrieval system