KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0186100-01Help
Entry
Os03t0186100-01   CDS       T02163                                 

Gene name
Os03g0186100
Definition
Similar to Uroporphyrinogen III synthase.
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dosa00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr03:join(4496734..4496928,4498216..4498303,4498468..4498534,4498774..4498892,4499022..4499117,4499232..4499287,4499613..4499698,4500127..4500261,4500429..4500480,4500559..4500573)
AA seq 302 aa AA seqDB search
MALSSSSHLLPFSRPPATFPRARHAGGGRGRAGATGRFIACSSPPPPDVVVTRERGKNAK
LIAALEKHNVQSLELPLIKHVEGPDTDRLSAVLRDEKFDWITITSPEAAAVFLEGWKAAG
NPKVRIAVVGAGTERVFDEVIQYNDGSLEVAFSPSKAMGKFLASELPRTTETTCKVLYPA
SAKAGHEIQNGLSNRGFEVTRLNTYTTVSVQDVDPLILKPALSAPVVAVASPSALRAWLN
LASQVDNWGNAIACIGETTASAAKKFGLKSIYYPTTPGLDGWVESILEALRAHGQSKEAP
GC
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccttgtcctcctcttcgcacctcctccccttctcccggcctcccgcgaccttccca
cgagcacgccacgccggcggcgggaggggccgagccggcgccacggggaggttcatagcg
tgctcctcgccccctcctcccgacgtcgtggtcacccgcgagcgcgggaagaacgccaag
ctcatcgccgcgctggaaaaacataatgtacaaagtcttgagcttcctcttattaaacat
gttgaagggccagatacagataggctttctgctgtcctgcgcgatgaaaagtttgactgg
atcactataacatctcctgaggcagctgctgtgttccttgagggatggaaggctgctgga
aatcctaaggtacgaatagcggttgttggagcaggtactgaaagagtttttgacgaagta
attcaatacaatgatggatcccttgaggttgcattttctccttctaaagctatgggtaaa
tttttggcctcagagcttccaaggaccactgaaactacttgtaaagtgttatatcctgca
tctgcaaaggctggccatgaaatccagaatgggctatcaaatcgaggatttgaggtgaca
agactgaacacatatacaactgtatctgtacaggatgtcgatccgctaatattaaagcct
gctctttcagctccagttgttgcagtagcttctccttctgctctccgagcttggctaaat
cttgcttcacaagttgacaactggggcaacgccattgcctgcataggcgagacgactgcc
tcagcagctaagaaatttggcctgaagagcatatattatcctaccaccccgggacttgac
gggtgggttgaaagcatccttgaagcgctcagagcccatgggcaatcgaaagaggcccca
gggtgttga

DBGET integrated database retrieval system