KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0190800-01Help
Entry
Os03t0190800-01   CDS       T02163                                 

Gene name
Os03g0190800
Definition
Similar to Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15) (Ubiquitin- specific processing protease 3) (AtUBP3).
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os03t0190800-01 (Os03g0190800)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os03t0190800-01 (Os03g0190800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:complement(join(4718911..4719027,4718241..4718357,4717500..4717598,4716431..4716616,4716134..4716315,4715486..4715885))
AA seq 366 aa AA seqDB search
MGAASSRLEKALGEQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFREQLLEYYANNKS
TGDVEDNMLTCLADLFSQISNQKKKTGVIAPKRFIQRLKKQNEIFRSYMHQDAHEFLNFL
LNELVDILEKESKVVAEPCENSSLKKNSNGPINVQLNGTKKEPVPTLVHKCFQGILTNET
RCLRCETVTDRDETFFDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQK
RMKIKKPPNILVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLINTVDNSDLEYSLFAVLV
HVGSGPNHGHYISLVKSHNHWLFFDDENVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE
SLAEKS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcgagctctaggctggagaaggcgctgggcgagcagttccccgagggcgag
cgctacttcggcctcgagaacttcggcaacacctgctactgcaacagcgtcctgcaggca
ctttacttttgtgttcctttccgtgagcaattactggagtactatgcaaataataaaagc
accggagatgtcgaagacaatatgttaacgtgcttagctgacctgttctctcagatcagc
aaccagaagaagaaaacaggtgttatcgctcctaagcgtttcatacaacgactgaagaaa
caaaatgagatttttcgcagctatatgcaccaggatgcacatgaatttctgaattttttg
cttaatgagctagttgacatcctagagaaagaatctaaagttgttgcagaaccttgtgaa
aattcctctttgaaaaagaattcaaacgggcctataaatgttcaactcaatggtactaaa
aaagaaccagttcctactttggtccacaaatgcttccagggcatattgactaatgaaaca
agatgtctaagatgtgagactgtgactgatagagatgaaacgttttttgacctaagtctg
gatattgaacagaatagttcaattaccagctgtcttaaaaacttcagctcgactgagact
ctgaatgctgaggataagttcttctgtgacaaatgctgcagtttgcaagaagcacagaaa
agaatgaagataaagaaaccaccaaacattcttgtaattcatctcaagcgcttcaagtat
attgaacagcttggtcgctacaaaaagctatcatatcgagttgttttccctctggagctt
aaacttatcaatactgttgacaactcagacttggaatattccctttttgctgtgctagtt
catgttggaagtggaccaaatcatggccactatatcagcttagtgaagagccacaaccac
tggttgttcttcgacgacgagaatgttgagatgactgatgagtccatggtacagacattc
tttggctcagcacaagagttcagtggtaacactgataacggctacatactcttctatgaa
agccttgctgaaaaaagttga

DBGET integrated database retrieval system