KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0192800-01Help
Entry
Os03t0192800-01   CDS       T02163                                 

Gene name
Os03g0192800
Definition
Similar to Ubiquitin-specific protease 26.
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os03t0192800-01 (Os03g0192800)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os03t0192800-01 (Os03g0192800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(4836614..4836690,4836818..4837414,4837907..4838168)
AA seq 311 aa AA seqDB search
MSRPNTRNKSKRPRADDCESPSAVFKKIHSTGAITKGDIKQLYMVWKPVCHGCHGNSKDS
PNCFCGLIPAANGVRKSGLWQRTNEIIRALGPNPSTDLRDSTETPAGLTNLGATCYANSI
LQCLYMNTSFRLGIFSLEPDILKMHPVLDQLARLFAQLHSSKMAFIDSAPFIKTLELDNG
VQQDSHEFLTLFLSLLEGSLSHSKVPGARTIVQHLFRGSVSHVTRCSSCGRDSEASSKME
DFYELELNIKGLNNLEQSLDDYLSTEALDGENQYFCESCQKRVDATRCIKLRSLPPVVNF
QLKRYVFLPKV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggccaaacacacgaaataagagcaagaggccgcgggctgatgactgcgagagc
ccgtctgctgttttcaagaagatacattccactggagcaatcacaaaaggcgatattaaa
caactttatatggtgtggaaacctgtttgtcatggttgccatgggaactccaaggactca
cccaattgtttctgcgggttgatccctgctgctaatggggtgaggaaatctggcctgtgg
cagagaacaaacgagatcattcgcgcccttggtcctaacccgtcgacggatcttcgtgac
tccactgagacgcctgctggattgactaacctgggcgctacctgttatgcaaacagcata
ctgcagtgcctttacatgaacacctccttccgcttgggcattttctctctagagcccgac
atcttgaagatgcaccctgtgctggatcagcttgctcggttattcgctcagctacactcc
agcaaaatggctttcattgattcggcaccttttataaaaaccttggaattagataatggt
gtccagcaggacagccatgaattcctcacattatttttgtctttgctcgagggttcacta
agtcattccaaggttccaggggctagaaccattgtgcagcatttgttccgtggaagtgtg
tcccatgttactcggtgctcatcatgtggaagggattccgaagcatcttcaaagatggaa
gacttttacgaactggagcttaacattaaaggtttaaataatctagaacaaagtttggat
gactatttgagtactgaggcactggatggagagaaccagtacttctgtgagtcatgtcag
aaaagggtagatgccactcgttgcataaaacttcgctcacttcctcctgttgttaatttt
cagctgaaacgctatgtattcctcccaaaggtgtag

DBGET integrated database retrieval system