KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0219400-01Help
Entry
Os03t0219400-01   CDS       T02163                                 

Gene name
Os03g0219400
Definition
Glycoside hydrolase, family 20 protein.
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dosa00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dosa00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dosa00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dosa00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dosa00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:complement(join(6281802..6282654,6280732..6281696))
AA seq 605 aa AA seqDB search
MAALPAYLLLLLLILVILRPAAAPGAASQPPTSEPHLPPPLLAQKVQVWPKPTSISWPSA
VYAPLSPSFSVRAVLSHPSLRQAVAFYTRLIRAERHAPLVPPANYTLSRVPVRTLTLSVS
DPDVPLGPAVDESYTLSVLPDSGSADISAATPWGAIRGLETFSQLAWAGGGAASGGQPIV
PSGIEISDRPHFTHRGILLDTARNFYPVRDILHTLRAMAFNKLNVFHWHITDAQSFPIVL
PTVPNLANSGSYSPTMRYTENDVRHIVSFAASFGIRVIPEIDMPGHTGSWAGAYPEIVTC
ANRFWAPHAEPALAAEPGTGQLNPLNPKTYRVAQDVLRDMVALFPDPYLHGGADEVNTAC
WEDDPVVRRFLAEGGTHDHLLELFINATRPFVAQELNRTVVYWEDVLLGPKVTVGPTILP
RETTILQTWNDGPENTKRVVAAGYRAIVSSASYYYLDCGHGGWVGNDSRYDKQEKEREGT
PLFNDPGGTGGSWCAPFKTWQRVYDYDILHGLTDDEAQLVLGGEVALWSEQSDETVLDAR
LWPRAAAAAETLWSGNKGSNGKKRYANATDRLNDWRHRMVERGIRAEPIQPLWCSLHPGM
CNLSQ
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcggcattgccggcctatctcctcctcctcctcctcatcctggtgatcctccgacca
gcggctgcgcccggcgccgcttcgcagccgcctacctcggagcctcacctcccgccgccg
ctgcttgctcagaaggtgcaggtgtggcccaagccgacgtccatctcgtggccgtccgcg
gtgtacgcgccgctctcgccgtcgttcagcgtccgcgcggtgctgtcccacccgtcgctc
cgccaggcggtagccttctacacccgcctcatccgcgccgagcgccacgcgccgctggtt
ccccccgccaactacaccctctcccgcgtccccgtccgcaccctcacgctctccgtctcc
gaccccgacgtcccgctcggccccgccgtcgacgagtcctacacgctctccgtgctcccg
gactccggatcggccgatatctccgccgccacgccatggggcgccatccgcgggctcgag
accttctcccagctcgcctgggccggcggcggcgccgcctccggtggccagccgatcgtc
cccagcggcatcgagatctccgaccgcccacacttcacccaccgcggcatcctcctcgac
accgccaggaatttctacccggtccgcgacatcctccacaccctccgcgccatggccttc
aacaagctcaatgtcttccactggcacatcaccgacgcccagtccttccccatcgtcctc
cctaccgtccccaacctcgccaactccggctcctactcccccaccatgcgctacaccgag
aacgacgtccggcacatcgtcagcttcgccgcctccttcggcatccgcgtcatccccgag
atcgacatgcccgggcacacgggttcgtgggcgggagcgtacccggagatcgtcacctgc
gcgaacaggttctgggcgccgcacgcggagccggcgctggcggcggagcccggcacgggg
cagctgaacccgctcaaccccaagacgtaccgcgtggcgcaggacgtgctgcgcgacatg
gtggccctgttcccggacccgtacctccacggcggcgccgacgaggtgaacacggcgtgc
tgggaggacgacccggtggtgcgccggttcctcgccgagggcggcacgcacgaccacctc
ctggagctgttcatcaacgcgacgcgcccgttcgtggcgcaggagctgaaccgcacggtg
gtctactgggaggacgtcctcctcgggcccaaggtcaccgtcggccccacgattctgccc
agggagaccaccatactgcagacgtggaacgacgggccggagaacacgaagcgcgtcgtc
gccgcgggctaccgcgccatcgtgtcgtcggcgtcgtactactacctggactgcggccac
ggcgggtgggtgggcaacgacagccggtacgacaagcaggagaaggagcgcgagggcacg
ccgctgttcaacgaccccggcggcacgggcgggtcatggtgcgcgccgttcaagacgtgg
cagcgcgtctacgactacgacatcctgcacgggctgaccgacgacgaggcgcagctggtg
ctgggcggggaggtggcgctgtggtcggagcagtcggacgagacggtgctggacgccagg
ctgtggccgagggccgccgccgccgcggagacgctctggtccggcaacaagggctccaac
gggaagaagcgctacgcgaacgccaccgaccgcctcaacgactggaggcaccggatggtc
gagcgcggcatccgcgccgagcccatccagccgctctggtgctcgctccaccccggcatg
tgcaacctgtcgcagtag

DBGET integrated database retrieval system