KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0262400-01Help
Entry
Os03t0262400-01   CDS       T02163                                 

Gene name
Os03g0262400
Definition
Similar to Eukaryotic translation initiation factor 4E type 3 (eIF4E type 3) (eIF-4E type 3) (mRNA cap-binding protein type 3) (Novel cap-binding protein) (nCBP).
Orthology
K03259  
translation initiation factor 4E
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Os03t0262400-01 (Os03g0262400)
Translation factors [BR:dosa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Os03t0262400-01 (Os03g0262400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr03:complement(join(8600356..8600511,8600106..8600198,8599910..8600014,8599729..8599806,8597541..8597660,8597328..8597459))
AA seq 227 aa AA seqDB search
MEPAAEKREAEQEELQQQHDEPAVPSADDDEAEAEENERRNRELKAGFHPLRRRFVLWYT
RRTPGARSQSYEDNIKKIVDFSTVESFWVCYCHLTRPVSLPSPTDLHLFKEGIRPLWEDP
ANRSGGKWIIRFKKTVSGRFWEDLVLVLVGDQLDYSDDVCGVVLSVRFNEDILSVWNRNA
SDHQAVMTLRDSIKRHLKLPHSYLMEYKPHDASLRDNSSYRNTWLRG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggagccggcggcggagaagagggaggccgagcaggaggagctgcagcagcagcacgac
gagcccgccgtcccttccgccgacgacgacgaggctgaggcggaggagaacgagcgccgc
aaccgcgagctcaaggccggcttccatccccttaggcgtagattcgtgctatggtacacg
cgccggactcctggggcgaggtcgcagtcctacgaggacaacatcaagaagatcgtcgac
ttcagcactgttgagtcgttctgggtttgctactgccacctcacgcggccggttagcctg
ccgagccccaccgacctgcatcttttcaaggagggcatccggcccctctgggaggatccc
gcaaataggagcggtggcaagtggatcataaggtttaagaagaccgtctctggtcgtttc
tgggaggatttggtgttggtgctagtgggtgatcaacttgattatagtgatgatgtttgt
ggcgttgtactcagtgttcgtttcaatgaggacattctaagtgtctggaaccgtaatgca
tctgaccaccaggctgtgatgacattaagagattcaattaagaggcatctgaagctgcca
cacagctatctgatggagtacaaaccacatgatgcttcactgcgggataactcatcttac
aggaacacgtggttgagaggataa

DBGET integrated database retrieval system