KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0265200-01Help
Entry
Os03t0265200-01   CDS       T02163                                 

Gene name
Os03g0265200
Definition
Similar to Josephin-like protein.
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os03t0265200-01 (Os03g0265200)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C86
   Os03t0265200-01 (Os03g0265200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr03:complement(join(8743825..8743977,8742599..8743054))
AA seq 202 aa AA seqDB search
MESGPKSEAKQDEEGSSAMGGGGGSSRSSKVYHERQRLQFCLLHALNNLMQEKESFTRAE
LDGIAGNLVQIDPNKEHWTPMSLIFKPHHNVFTGNYDVNVLITALEARKKKVIWHDHRKG
ASSIDLDADALFGLMINVPVRRFRGLWTGRHWVAIRSINGTWFNLDSDFSAPKEFQDKEK
LIAFLDSILSQGGEVMIVLQDE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaatcggggcccaaatcggaagcaaaacaagacgaggagggatcgagtgcgatgggc
ggcggcggcggcagcagcagaagcagcaaggtgtatcacgagaggcaacggctgcagttc
tgtctcctccacgccctcaacaaccttatgcaggaaaaggaatctttcacccgagctgag
ttagatgggattgctggaaatctcgtccagattgatccaaataaggagcactggactcct
atgtcattgatttttaagccccaccacaacgtattcaccgggaactatgatgtaaatgta
ctcatcacagcattagaagctagaaagaagaaggtaatctggcatgatcatcggaaaggg
gcttcttcaatcgatctggatgcagatgcattgtttggtctgatgatcaatgtacccgtc
aggaggttcagagggctttggactggccggcattgggtggcaattcgaagcattaatggc
acttggtttaatttggatagtgatttttctgcacccaaggagtttcaggacaaagaaaaa
cttattgcatttctagacagcattctcagtcaaggtggagaagtcatgatagtgctgcaa
gatgaataa

DBGET integrated database retrieval system