KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0268000-01Help
Entry
Os03t0268000-01   CDS       T02163                                 

Gene name
Os03g0268000
Definition
Similar to Protein phosphatase 1, catalytic gsmms subunit.
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Os03t0268000-01 (Os03g0268000)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Os03t0268000-01 (Os03g0268000)
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Os03t0268000-01 (Os03g0268000)
Transcription machinery [BR:dosa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Os03t0268000-01 (Os03g0268000)
Spliceosome [BR:dosa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Os03t0268000-01 (Os03g0268000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(8884330..8884549,8886928..8887487,8887573..8887761)
AA seq 322 aa AA seqDB search
MAAAPGAGGQGGGGMDAVLLDDIIRRLLEVRTARPGKQVQLSESEIRQLCTVSREIFLSQ
PNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLA
YKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKVFTDCFNCLPVAALIDDKI
LCMHGGLSPDLTHLDEIKSLPRPTDVPDTGLLCDLLWSDPGKDVQGWGMNDRGVSYTFGA
DKVSEFLEKHDLDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNAGAMMSVDETL
MCSFQILKPAERKGKFMASNKM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcaccgggggcgggagggcagggcggcggcgggatggacgccgtcctcctc
gacgatatcatccgccgcctgctcgaggtgcggacggcgcgcccggggaagcaggtgcag
ctctccgagtcggagatccgccagctctgcactgtatcccgagaaatcttcctcagccag
cccaatctcctcgagctcgaggcgcccatcaagatctgcggtgacatccatggtcagtac
agtgaccttctaaggctttttgagtatggtggttttcccccagaagccaattatctattc
ttaggtgattatgttgatcgaggcaaacaaagtttggaaacaatatgcctcctccttgca
tacaaaatcaagtacccggagaatttttttcttctcagaggcaatcatgagtgtgcatca
ataaacaggatatatggattttatgatgaatgcaaacgccgatttaatgtgcgtctatgg
aaggtcttcactgattgttttaactgtctccctgtggctgcgctaattgatgataaaata
ttatgcatgcatggtggcctctctcctgatctgacacatttagatgagataaagagcttg
ccccgtcctactgatgtaccggatacaggtctgctatgcgacctactttggtcagatcca
ggaaaagacgttcaaggttggggcatgaatgataggggggtctcatacacttttggtgct
gacaaagtttcagaattcctggaaaaacatgaccttgatcttatttgccgggcacatcag
gttgttgaggatggatatgagttctttgccgacagacaacttgtcaccatattctcagct
ccaaactattgtggtgaatttgataatgcaggtgcaatgatgagtgttgatgaaactttg
atgtgttcttttcaaattcttaaacctgctgagagaaaaggcaaatttatggcatcaaac
aaaatgtga

DBGET integrated database retrieval system