KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0289300-00Help
Entry
Os03t0289300-00   CDS       T02163                                 

Gene name
Os03g0289300
Definition
Similar to Phosphoinositide-specific phospholipase C.
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Os03t0289300-00 (Os03g0289300)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Os03t0289300-00 (Os03g0289300)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Os03t0289300-00 (Os03g0289300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(10024083..10024538,10025404..10025600,10025700..10025835,10025913..10026164,10026253..10026482,10026589..10026706,10026778..10026930,10027020..10027106,10027301..10027591)
AA seq 639 aa AA seqDB search
MHARCAFRLTRLRREPDAEPGRAGKQGKSVCAAKVHEGGAGAGDAQMGTYKCCIFFTRRF
ALSDASTPGDVRMLFTRHAGGAPYMGIDELRRYLAASGEAHVDADTAERIIDRVLQERSR
TPRFGKPSLTIDDFQYFLFSEDLNPPICHSKEVHHDMNAPLSHYFIYTGHNSYLTGNQLS
SDCSDIPIIKALQIGVRVIELDMWPNSSKDDVDILHGRTLTAPVSLIKCLKSIKEYAFVA
SPYPVIITLEDHLTSDLQAKVAKMVLEVFGDTLYYPESKHLQEFPSPEALRGRVILSTKP
PKEYLESKGGTMKDRDIEPQFSKGQNEEAVWGTEVPDIQDEMQTADKHENDILYTQRDVE
EDDEKKMCQHHPLEYKHLITIKAGKPKGAVVDALKGDPDKVRRLSLSEQELAKVAAHHGR
NIVSFTHKNLLRIYPKGTRFNSSNYNPFLGWVHGAQMVAFNMQGYGRSLWLMHGFYKANG
GCGYVKKPDFMMQTCPDGNVFDPKADLPVKKTLKVKVYMGEGWQSDFKQTYFDTYSPPDF
YAKVGIAGVPSDSVMQKTKAVEDSWVPVWEEEFVFPLTVPEIALLRVEVHEYDVSEDDFG
GQTALPVSELRPGIRTVPLFDHKGLKFKSVKLLMRFEFV
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcgcggtgcgcgttccgcctcacacgcctccgtcgggagccagacgccgagccg
ggacgagcgggcaaacagggaaaaagcgtgtgcgcggcgaaggtccatgaaggcggcgcc
ggcgccggcgacgcgcaaatggggacgtacaagtgctgcatcttcttcacccgcaggttc
gcgctgagcgacgcgtccacgccgggcgacgtgcgcatgctgttcacccgccacgccggc
ggcgcgccctacatgggcatcgacgagctccggcgctacctcgccgccagcggggaggcc
cacgtcgacgccgacacggcggagcggatcatcgaccgggtcctgcaggagcgcagccgc
accccgcgcttcgggaagccgtcgctcaccatcgacgatttccagtacttcctcttctcc
gaggacctcaacccgcccatctgccattccaaggaagtccatcacgacatgaatgcacca
ttatcgcactacttcatatacactggacacaactcgtatctgacgggcaatcaacttagc
agtgactgcagtgatattcccatcattaaggcactgcaaataggcgtccgtgtaattgaa
ctggacatgtggccaaattcttctaaagatgatgttgatattctccatggaaggacactg
actgccccagtatcacttatcaaatgcttgaaatccatcaaagaatatgcctttgttgcg
tctccctaccctgttattataacattagaagaccaccttacatctgatcttcaggcgaaa
gtagctaagatggttcttgaagtatttggagataccctatattatcccgagtcaaaacat
cttcaagaatttccttcacccgaagcactgaggggacgtgtcatcctctcaacaaaaccc
ccaaaggagtaccttgaatcaaaaggtggtactatgaaagacagagacattgagcctcag
tttagcaaaggacaaaatgaagaagctgtctggggaacagaagtcccagatattcaggat
gagatgcaaaccgccgacaagcatgagaatgatatactatacacccaaagagatgtggaa
gaagatgatgagaagaaaatgtgccagcatcacccactagagtataaacaccttattact
attaaggcaggaaagccaaagggtgctgtagttgatgccttaaagggtgatccagataaa
gttagacgcctcagtttgagtgagcaggaacttgcaaaagtggcagcgcatcatggtcgt
aacatcgtgagctttacacataaaaatcttctgagaatatacccaaagggcactcgcttc
aattcttcgaactataatccgtttcttggttgggtgcatggtgcacaaatggtggcattt
aatatgcaggggtatggaagatctctttggctaatgcacggattctacaaggccaacggt
ggctgcggttatgtgaagaagccagatttcatgatgcaaacttgtccagatggaaatgtt
tttgacccgaaagcagatttacctgtgaagaaaacactcaaggtcaaagtatacatgggc
gaaggttggcagagcgacttcaagcagacatacttcgacacgtattcccctccagacttc
tacgcaaaggtgggcattgccggggttccgtcggactcggtgatgcagaagacgaaagcc
gtggaggacagctgggttcccgtgtgggaggaggagttcgtgttcccgctgaccgtcccg
gagatcgcgctgctccgcgtggaggtgcacgagtacgacgtgagcgaggacgacttcggc
gggcagacggcgctcccggtgtcggagctgcggccggggatccgcaccgtgccgctcttc
gaccacaaggggctcaagttcaagagcgtcaagctcctcatgcggttcgagttcgtctag

DBGET integrated database retrieval system