KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0291500-01Help
Entry
Os03t0291500-01   CDS       T02163                                 

Gene name
Os03g0291500, ASN1, ASPARAGINE_SYNTHETASE_1
Definition
Similar to Asparagine synthetase.
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dosa00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:complement(join(10124205..10124286,10123562..10123698,10123343..10123441,10123084..10123225,10122745..10122935,10122459..10122620,10122271..10122351,10121813..10122034,10121563..10121697,10121382..10121462,10121208..10121294,10121015..10121122,10120614..10120901))
AA seq 604 aa AA seqDB search
MCGILAVLGAADWSQAKRAHVLSCSRRLKHRGPDWSGLYQCEGNFLAQQRLAIVSPLSGD
QPLYNADRTIVVVANGEIYNHKKIRKQFASKHTFSTGSDCEVIIPLYEEYGEDFVDMLDG
VFAFVLYDTRTKTYMAARDAIGVNPLYIGRGSDGAVWISSEMKALNEDCVEFEIFPPGHL
YSSAAGGLRRWYKPQWFAENVPATPYQPLLLREAFEKAVIKRLMTDVPFGVLLSGGLDSS
LVAAVTKRHLIKTEAAEKFGAELHSFVVGLEGSPDLIAAREVADHLGTIHHEFHFTVQDG
IDAIEEVIYHDETYDVTTIRASTPMFLMARKIKALGVKMVLSGEGSDELLGGYLYFHFAP
NKEEFHKETCRKVKALHQYDCLRANKATSAWGLEVRVPFLDKEFINVAMSMDPEWKMYNA
DLGRIEKWVMRKAFDDEEHPYLPKHILYRQKEQFSDGVGYNWIDGLKAFTEQQVSDEMMK
NAAKVYPHNTPVNKEAYYYRMIFERLFPQESARETVPWGPSIACSTPAAIEWVEQWKASH
DPSGRLIASHNSASASANHTNHANANANGNSNGKANGNCAMAANGTNGVGLVVANGTANG
KMEA
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatcctggccgtgctcggcgccgccgactggtcgcaggcgaagagggctcac
gtcctctcctgctcccgcaggctgaagcacaggggacccgactggtccgggttgtaccag
tgcgagggaaacttcctcgctcagcagcgtctcgccatcgtctccccgctctccggcgac
cagccgctgtacaacgcggaccggaccatcgtcgtcgtggccaatggagagatctacaac
cacaagaagatcaggaagcagttcgcctccaagcacacgttcagcaccggcagcgactgc
gaggtcatcatcccgctgtatgaggagtacggcgaggacttcgtcgacatgctggacggc
gtgttcgccttcgtcctctacgacacccgcaccaagacgtacatggccgcccgcgacgcc
atcggcgtcaaccccctctacatcggcaggggcagcgacggcgccgtctggatatcgtcc
gagatgaaggcgctgaacgaggactgcgtggagttcgagatcttccctccgggccacctc
tactccagcgccgccggcgggctccggcggtggtacaagccgcagtggttcgccgagaac
gtcccggcgacgccgtaccagccactcctcctcagagaggccttcgagaaggccgtcatc
aagaggctcatgaccgacgtgcccttcggcgtcctcctctccggcggcctcgactcctcc
ctcgtcgccgcggtgaccaagcgccacctcatcaagactgaagccgccgagaagttcgga
gctgagctccattccttcgtcgttggccttgagggttcccctgacctgatagctgcacga
gaggtcgctgaccacctaggaaccatccatcacgagttccacttcactgtccaggatggc
atcgacgcgatcgaggaggtcatctaccacgacgagacgtacgacgtgacgacgatacgg
gccagcacgccgatgttcctgatggcgcgcaagatcaaggcgctcggggttaagatggtg
ctgtccggtgaaggctccgacgagctcctcggcggttacctctacttccacttcgccccc
aacaaggaagagttccacaaggagacctgccgcaaggtgaaagcacttcatcagtatgac
tgtctgcgtgctaacaaggcgacgtctgcctggggactggaggtccgtgtgccgttcctc
gacaaggagttcatcaacgtcgccatgagcatggaccctgagtggaagatgtacaatgct
gatcttggtcgcatcgagaagtgggttatgaggaaggcgttcgacgacgaggagcatcct
tacctgccgaagcacatactgtacaggcagaaagagcagttcagtgatggcgtcggctac
aactggatcgatggcctgaaggctttcaccgagcagcaggtcagtgatgaaatgatgaag
aacgctgccaaagtgtacccgcacaacacgcccgtcaacaaggaggcgtactactaccgc
atgatatttgagaggctcttcccgcaggaatcggcgagggagacggtgccgtggggcccg
agcatcgcgtgcagcacgccggcggcgatcgagtgggtggagcagtggaaggcgtcgcac
gacccatccggccggctgatcgcctcccacaactccgcctccgcctccgccaaccacacc
aaccacgcaaacgccaacgccaacggcaacagcaacggcaaggccaacggcaactgcgcg
atggcggccaacgggacgaacggcgtcggcctggttgtggccaacgggacagccaacggg
aagatggaagcataa

DBGET integrated database retrieval system