KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0300500-01Help
Entry
Os03t0300500-01   CDS       T02163                                 

Gene name
Os03g0300500
Definition
Similar to Pectin methylesterase 6 (Fragment).
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dosa00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dosa00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:complement(10564996..10566693)
AA seq 565 aa AA seqDB search
MSKGAIIGASTVLVVAVVAAVCVVSFKNGSSNAKEDGELSTSVKSIKSFCQPVDYRETCE
TTLEQTAGNATNPTDLAKAIFKATSERIEKAVRESAVLNDLKNDPRTSDALKDCEELLDY
AIDDLKTTFDKLGGFQTSNFKRAVDDVKTWLSSALTYQETCLDGFENSTSTEASEKMRKA
LKSSQELTENILAIVDQFADTLANLDITGFSRRLLGDDGVPVWMSNAKRRLLEATPGSKE
FKPDVTVAADGSGDFKTINEALAKVPVKSTGTYVMYVKAGTYKEYVSVARNVTNLVMIGD
GATKTIITGNKSFMLNITTKDTATMEAIGNGFFMRGIGVENTAGSKNHQAVALRVQSDQS
AFYECQFDGHQDTLYTHTSRQYYRDCTITGTIDFIFGNAQVVLQNCRIQVRRCMDNQQNI
VTAQGRKEKHSAGGTVIHNCTIEPHEDFKADAAKFKTFLGRPWKEYSRTLYIQSDIGGFI
DPQGWLPWLGDFGLNTCYYAEVENRGDGADMSKRAKWRGVKTVTYQQAQQKYTVERFIQG
QTWLPKFGVPFIPGLLPQEQSGRIH
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggcgcgatcatcggcgcgtcgaccgtgctggtggtggcggtggtggcggcg
gtgtgcgtggtgtcgttcaagaacgggtcgagcaatgccaaggaggacggcgagctgtcg
acgtcggtgaagtcgatcaagtcgttctgccagccggtggactaccgggagacgtgcgag
accacgctggagcagacggcgggcaacgcgacgaacccgacggacctcgccaaggccatc
ttcaaggcgacgtcggagcggatcgagaaggcggtgagggagtccgccgtgctcaacgac
ctcaagaacgacccgcgcacgtccgacgcgctcaaggactgcgaggagctgctcgactac
gccatcgacgacctcaagacgacgttcgacaagctcggcgggttccagacgagcaacttc
aagcgcgccgtggacgacgtcaagacgtggctcagctcggcgctgacgtaccaggagacg
tgcctcgacgggttcgagaactctacgtcgacggaggcgtcggagaagatgcgcaaggcg
ctcaagagctcgcaggagctgacggagaacatcctcgccatcgtggaccagttcgccgac
acgctggcgaacctggacatcaccggattcagccgccggctgctcggcgacgacggcgtg
cccgtgtggatgtccaacgcgaagcgccggctgctggaggcgaccccgggctccaaggag
ttcaagccggacgtgacggtggcggcggacggcagcggcgacttcaagaccatcaatgag
gcgctggccaaggtgccggtcaagagcacggggacgtacgtgatgtacgtgaaggccggg
acgtacaaggagtacgtgtcggtggcgcgcaacgtgacgaacctggtgatgatcggcgac
ggcgccaccaagaccatcatcacggggaacaagagcttcatgctcaacatcaccaccaag
gacacggccaccatggaggcgatcggcaacgggttcttcatgcgcggcatcggcgtggag
aacacggccgggtccaagaaccaccaggcggtggcgctccgcgtgcagagcgaccagtcg
gcgttctacgagtgccagttcgacgggcaccaggacacgctctacacccacaccagcagg
cagtactaccgcgactgcaccatcaccggcaccatcgacttcatcttcggcaacgcgcag
gtggtgctccagaactgccggatccaggtgcgccggtgcatggacaaccagcagaacatc
gtgacggcgcaggggcgcaaggagaagcactccgcgggcggcacggtgatccacaactgc
accatcgagccgcacgaggacttcaaggccgacgccgccaagttcaagacgttcctcggc
cgcccgtggaaggagtactcgcggacgctctacatccagtccgacatcggcgggttcatc
gacccgcaggggtggctgccgtggctcggcgacttcggcctcaacacctgctactacgcc
gaggtggagaaccgcggcgacggcgccgacatgagcaagcgcgccaagtggagaggggtc
aagacggtcacgtaccagcaggcgcagcagaagtacaccgtcgagaggttcatccaggga
cagacgtggctcccaaagttcggcgtgccgttcatccccggcctgttgccgcaggagcag
tcagggaggatacactga

DBGET integrated database retrieval system