KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0307800-01Help
Entry
Os03t0307800-01   CDS       T02163                                 

Gene name
Os03g0307800, ENHANCER_OF_ZESTE_1, IEZ1
Definition
SET domain-containing protein.
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Os03t0307800-01 (Os03g0307800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr03:complement(join(10959571..10959621,10959372..10959483,10958914..10959250,10958176..10958334,10957473..10957557,10957217..10957354,10957050..10957097,10956827..10956898,10955472..10956121,10955233..10955383,10953981..10954198,10953629..10953760,10953355..10953445,10953217..10953264,10953000..10953128,10952831..10952908,10952568..10952756))
AA seq 895 aa AA seqDB search
MASSSSKASDSSSQRPKRPDQGPSGKDAAGLVALHGKLAQLKRQVQSTRLAAIKERVEAN
RKALQVHTCALFDVAAAAEVASRGAEGGNALSRGAAEGHRRFVGWDSASGPGERELVHVQ
EENLVAGTLVLSSSGGSGASHRTVVQLVKLPVVDKIPPYTTWIFLDKNQRMADDQSVGRR
RIYYDPIVNEALICSESDDDVPEPEEEKHVFTEGEDQLIWKATQDHGLSREVLNVLCQFV
DATPSEIEERSEVLFEKYEKQSQSSYKTDLQLFLDKTMDVALDSFDNLFCRRCLVFDCRL
HGCSQNLVFPSEKQPYGHELDENKRPCGDQCYLRRREVYQDTCNDDRNACTTYNMDSRSS
SLKVSATILSESEDSNRDEDNIKSTSIVETSRSKITNSEYADKSVTPPPGDASETENVSP
DMPLRTLGRRKISKHASKSNDHSPDKRQKIYSSPFPFAMSVLNKQSVPEIGETCPDSIES
AVDQLPSLDDPNKKISTKDMCAGSTTNTTENTLRDNNNNLFISNKEHSISHWSALERDLY
LKGIEIFGKNSCLIARNLLSGLKTCMEVASYMYNNGAAMAKRPLSGKSILGDFAEAEQGY
MEQDLVARTRICRRKGRARKLKYTWKSAGHPTVRKRIGDGKQWYTQYNPCGCQQMCGKDC
ACVENGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAASRECDPDVCRNCWVSCG
DGSLGEPLARGDGYQCGNMKLLLKQQQRILLGKSDVAGWGAFIKNPVNRNDYLGEYTGEL
ISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKGDKLKFANHSSNPNCYAKVMLVAGD
HRVGIYAKDRIEASEELFYDYRYGPDQAPAWARRPEGSKKDEASVSHHRAHKVAR
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcctcgtccaaggcctccgattcctcttcccaacgccccaagcggccggat
caagggccgtcgggcaaggacgcggccggcctcgtcgcgctgcacgggaagctggcgcag
ctgaagcgtcaggtccaatccacccgcctcgccgcgatcaaggagagggtggaggcgaac
aggaaggcgctgcaggtgcacacgtgcgctctgttcgacgtcgccgcggcggcggaggtg
gcgtcgcggggcgccgagggcggcaacgcgctgtcgcggggcgcggcggaggggcaccgc
aggttcgtggggtgggactcggcgagcgggccgggggagagggagttggtgcatgtgcag
gaggagaatctggtcgccgggacgctcgtgctctcgagctctggtggtagcggcgcctcg
cataggaccgtcgtgcagcttgtgaagctgcctgtggtcgacaagattccgccctacacc
acgtggatcttcctggacaaaaaccaaagaatggccgatgatcagtcagttggtaggagg
agaatttactacgacccaattgtcaatgaggctctgatctgcagtgaaagtgacgatgat
gttccagagccagaggaagagaaacatgttttcacagaaggagaagatcagctaatatgg
aaagctactcaagatcatgggttaagtcgagaggttttaaatgtcctctgccagtttgtt
gatgcaactccttcagaaattgaggaaagatcagaagttctttttgagaaatatgagaag
cagtctcaatcttcttacaagacagatttgcaactttttcttgacaagaccatggatgtg
gctttagattcttttgataatctcttctgtcggagatgtttggtttttgattgccgtctc
catgggtgctcccagaacttggtattccctagcgagaagcaaccatatggtcatgaactt
gatgaaaacaagagaccgtgtggcgatcagtgctaccttcgaaggagagaagtatatcaa
gatacgtgcaatgatgaccgaaatgcttgtacaacatataatatggattcaagatcttcc
tcactcaaagttagtgctaccatattgtctgaatcagaagattcaaacagagatgaagat
aacatcaaatccacttctattgttgaaaccagcagatcaaaaataactaattctgaatat
gctgacaaaagtgtgacaccacctcctggagatgcttctgaaactgaaaatgtgtcccct
gacatgcccctaagaactttaggcaggcgtaagatttcaaagcatgcctccaagtctaac
gatcattcacctgataaaaggcagaagatatatagctcaccgtttccttttgcaatgagt
gtactgaacaagcaatctgttccagaaattggtgagacatgtccagattccatagaatct
gcagttgatcaacttccaagtctggatgaccctaacaagaaaatttctaccaaagatatg
tgtgctggaagcacaactaacactactgaaaatacattacgagataataataataatttg
ttcatctccaacaaggagcactctatttctcattggagtgctttagagagagatttgtac
ttgaagggaattgagatatttgggaaaaacagttgtctcatagctagaaacctattgtct
ggcctgaagacctgcatggaagtggccagctacatgtacaacaatggtgcggcaatggca
aagagacctctatctggtaaatccattttaggtgactttgcagaggctgaacaaggttac
atggagcaagatttggtggcaaggacaagaatctgtcgtcgtaagggccgagctcgaaag
ctcaaatacacttggaagtctgcagggcatccaactgtaagaaaaagaatcggtgatgga
aagcaatggtacactcagtataacccatgtgggtgtcagcaaatgtgtggcaaagattgc
gcctgtgtggaaaatggaacttgttgcgagaagtactgcgggtgctcaaagagctgcaaa
aataggtttagaggatgtcattgcgcaaaaagtcaatgcagaagcagacagtgcccgtgt
tttgctgccagtcgtgaatgtgatccagatgtttgcagaaactgctgggtgagctgcgga
gatggctcactaggtgagccactggcaagaggtgatggctatcagtgtggaaacatgaaa
ctcctcttaaaacaacaacaacgtatattgcttggaaaatctgatgttgcgggttggggt
gcattcattaagaacccagtaaatagaaatgattaccttggtgaatacactggcgaattg
atttctcatagagaagcagataagcgtggcaaaatatatgatcgagcaaattcatcgttc
ctatttgatttaaatgagcagtatgtactggatgcttatcgcaagggggataaactgaag
tttgcaaatcactcgtcgaatcctaactgctatgcgaaggttatgttggtggctggcgat
catcgagttggtatctatgcaaaggaccgcattgaggctagcgaggaactcttttatgat
taccgctatggacctgaccaagccccagcttgggctaggagaccggaagggtcaaaaaag
gatgaagcatctgtctctcaccaccgagcgcacaaagttgctagatag

DBGET integrated database retrieval system