KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0320400-01Help
Entry
Os03t0320400-01   CDS       T02163                                 

Gene name
Os03g0320400
Definition
SET domain containing protein.
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Os03t0320400-01 (Os03g0320400)
Enzymes [BR:dosa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Os03t0320400-01 (Os03g0320400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(11560362..11560554,11560681..11562092)
AA seq 534 aa AA seqDB search
MESNQHKASDPQDSMVHLDLDEDKIMVTSALPCPSMSVGKSVMRKRGRPSRHARGTSLSS
VTPEGCKKMEGRSYNLRSDSTILLRNSCLLIADGSTKQKRSWGLDKDDLHIPFFQISDNP
REAVDDILMTFGGLHRRIMQLIDVKMASKQLVFQALNLMRKVGYHVNKDKRVGEVPGVKI
GDIFYSRIEMLLVGLHSNINRGIEFMSGAFINKEDKIATCIVSSGMYENGDDDPYTLVYN
GQGKVHHKLERGNYSLNQSFIRRNHIRLIRSEPNPLVRLGSKEKIYIYDGLYKIEEKYRQ
TTKSRSNLKFNKLVRELGQPNGIVVWKNTQKWRENPSCRDHVIMPDMSNGAEIARVCVVN
NIDSEDAPNNFTYSTKLDNGNHMVSANKMCVCKCTSSCLGEDNCSCLKTNGSYLPYNSSG
ILVCRKTMIYECNDSCACTINCSNRVVQRGSYLHFEVFKTMDRGWGLRSWDPIPAGAFVC
EYVGVVIDKDSLVEEDEYIFEVTRPEHNLKWNYLPELIGEPSFYDMNDTFKKLC
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaccaacacaaagcatcagatccacaggattctatggttcatttagatctg
gatgaagataagataatggtgacatcagcattaccatgtccttcaatgtccgtgggaaaa
tcggttatgaggaagaggggaagaccaagcaggcatgcacgaggaacttcgttgtcttct
gttaccccagaagggtgcaagaagatggagggtcgatcatataatttgcgtagtgattca
acaattttgttgagaaattcatgtttgctaatagctgatggatcgacaaaacagaagcga
tcttggggacttgacaaggatgacttgcatatacctttctttcaaatttcagataatcct
agggaagctgttgatgatatactcatgacatttggtggactacatcggaggatcatgcag
ttgatagatgtgaaaatggcttcaaaacagcttgtcttccaagcattgaacctcatgaga
aaagttggatatcatgttaacaaggacaagagggttggagaggtcccaggagttaaaatt
ggtgacatattctactctagaattgagatgctcttggtagggctacatagtaacatcaat
agaggaattgaattcatgtctggtgcttttattaataaggaagataagatagctacatgc
attgtgtcatctggaatgtatgagaatggtgatgatgacccatatactttggtatataat
ggccaaggcaaagtccaccataagcttgagagaggtaactattcgttgaatcagagtttt
attagaaggaatcatattagacttattcgtagtgaaccaaatccattggttaggctaggc
tcaaaggaaaaaatatacatatatgatggtctttataagatcgaagaaaagtacagacaa
acaacaaaatctcgttctaacttaaagttcaacaagttggtcagggaactaggccagcct
aatggcattgtagtatggaagaatactcagaaatggagggaaaatccatcttgtagagat
catgtcataatgcctgacatgtcaaatggtgcagaaatagctcgtgtttgtgttgtaaac
aacattgatagtgaggatgctcctaacaactttacctattcaactaaacttgataatggg
aatcatatggtttcagcaaacaagatgtgtgtctgcaaatgcacaagctcatgccttggt
gaagacaattgctcttgtttgaaaacaaatggcagctatttaccttacaactcttcagga
atacttgtttgtcgaaagactatgatatatgagtgcaatgattcatgtgcttgcacaatt
aattgctcgaaccgagtggtacagaggggttcctatctacactttgaagtgttcaagacg
atggatcgaggttggggccttcgcagttgggatcccattccggcgggtgcatttgtatgt
gaatatgttggtgtagttattgacaaagatagcttagttgaagaagatgaatacatattt
gaggttactagaccagagcataatttaaaatggaactatttaccagaattgataggtgaa
ccttctttctatgacatgaatgatacattcaagaagttgtgttaa

DBGET integrated database retrieval system