KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0320900-01Help
Entry
Os03t0320900-01   CDS       T02163                                 

Gene name
Os03g0320900, VIRESCENT_2, V2
Definition
Guanylate kinase family protein.
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Os03t0320900-01 (Os03g0320900)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Os03t0320900-01 (Os03g0320900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(11595556..11595750,11595843..11595974,11596075..11596266,11598336..11598674)
AA seq 285 aa AA seqDB search
MLLTRRFSSALARSPLLPRSLPPPRAVPATPPAPRPPPRRLMSSSSSGWHHSSRPPPPPP
SGADKDQLFRGLEAALGTTFSSEPLAPPPQPMILVISGPSGVGKDAVIQRLQEEREGMHF
VVTATSRAKRPGEVDGKDYYFVTKEEFLTMIERKELLEYALVYGEYKGIPKQQIRDYMAK
GYDIVLRVDIQGAATLREILGESAIFIFLVAESEEALVKRLIHRKTETSDMLLVRVATAR
EEVKRMNNFDYVVVNSEGNLEGAVKQVESIIDAEKAKVHKRTVNI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcacgcgaaggttctcctccgccctcgcgcgctccccccttctccccaggtcc
ctccctcctccgcgggccgtgcccgccacccctccggcgccccgcccgccgccgcgccgc
ctcatgtcctcctcctcctccggctggcaccactcctctcgcccgcccccgccgcccccc
tccggcgccgacaaggatcagctgttccgggggctggaggcggcgctcggcacgacgttc
agctcggagccgctcgcgccgccgccgcagccgatgatcctcgtcatcagcgggcccagc
ggcgtcggcaaggacgctgtcatccagaggctgcaagaagagagggaggggatgcatttc
gttgtcaccgcgacaagcagagcgaagcggcccggtgaagttgatgggaaggactattac
ttcgtcaccaaggaggagttcctcacgatgattgaaaggaaggagttgctcgagtacgca
cttgtctatggggagtataaggggatccccaagcagcagatccgtgattacatggcgaaa
ggttatgatattgtcttgagagtggacattcaaggagcagcaaccttgagagagattctt
ggcgaatcagcaattttcatctttttggttgcagagagtgaagaggcacttgtcaaaagg
ctaattcaccgcaaaacagaaacatcagatatgcttcttgtcagagttgcaacggccaga
gaagaggtgaaacgcatgaacaattttgattatgtagttgtcaattctgaagggaatctt
gagggggctgttaaacaggtggagtctatcattgatgctgagaaggctaaggtccacaaa
cgtacggttaatatctag

DBGET integrated database retrieval system