KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0358100-01Help
Entry
Os03t0358100-01   CDS       T02163                                 

Gene name
Os03g0358100
Definition
Similar to Glutathione peroxidase.
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Os03t0358100-01 (Os03g0358100)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Os03t0358100-01 (Os03g0358100)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Os03t0358100-01 (Os03g0358100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(13879150..13879203,13879317..13879393,13879526..13879587,13880042..13880160,13881739..13881906,13881994..13882023)
AA seq 169 aa AA seqDB search
MGAAESVPETSIHEFTVKDCNGKEVSLEMYKGKVLIVVNVASKCGFTETNYTQLTELYQK
HRDKDFEILAFPCNQFLRQEPGSDQQIKDFACTRFKAEYPVFQKVRVNGPDAAPLYKFLK
ASKPGLFGSRIKWNFTKFLIDKNGKVINRYSTATSPLSFEKDILKALED
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgggggcggcggaatccgtgccggagacctccatacacgaattcaccgtcaaggattgc
aacggcaaggaggtgagcctggagatgtacaaggggaaggtgctaatcgtcgtcaacgtc
gcctccaaatgtgggttcacggagaccaactacacgcagctgacggagctctatcagaaa
cacagggacaaagattttgagattctagcatttccctgcaatcagttcttgcgacaagag
ccaggatctgaccagcaaataaaggattttgcttgcacaagatttaaagctgaatatccc
gtttttcagaaggtgcgtgtaaatggtcctgatgctgcaccactttacaaatttttgaaa
gctagcaagcctggcttgtttggatctagaatcaagtggaactttaccaaatttcttatt
gataagaatggcaaagtcattaacagatactcgactgcgaccagtcccttgtcttttgag
aaagacatcctgaaggcgctcgaggattag

DBGET integrated database retrieval system