KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0370000-01Help
Entry
Os03t0370000-01   CDS       T02163                                 

Gene name
Os03g0370000
Definition
Similar to Pyruvate dehydrogenase kinase isoform 1 (EC 2.7.1.99).
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Os03t0370000-01 (Os03g0370000)
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   Os03t0370000-01 (Os03g0370000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(14526487..14526729,14527699..14527960,14528473..14528653,14528981..14529128,14529676..14529880,14530144..14530202)
AA seq 365 aa AA seqDB search
MMAYSEPAARAVAEEVARWGGMRQTGVTLRYMMEFGARPTERNLLRSAQFLRRELPIRIA
RRALDLDSLPFGLSTKPAILKVRDWYLDSFRDLRCFPEVRNRDDELAFTEMIKMIRVRHN
NVVPTMALGVRQLKKDLGGTKAFPPGIDEIHQFLDRFYMSRIGIRMLIGQHVALHEPDPE
PGVIGLISKRLSPMLVAQHATEDARAICMREYGSAPDVNIYGDPDFTFPYVKLHLQLMMF
ELVKNSLRAVQERYMNSDKHAPPVRIIVADGAEDVTIKISDEGGGIPRSGLSRIFTYLYS
TAENPPDLDGRNEGVTMAGYGYGIPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDS
EEPLH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgtactcggagccggcggcgagggcggtggcggaggaggtggcgcggtgggga
gggatgaggcagacgggggtgacgctgcggtacatgatggagttcggggcgcgccccacg
gagaggaacctgctgcggtcggcgcagttcctgcgcagggagctccccatccgcatcgcc
cgccgcgcgctcgacctcgactccctccccttcggcctctccaccaagcccgccatcctc
aaggtgagagattggtatttggactcattccgcgacttacggtgcttcccggaggtgagg
aaccgggatgatgagcttgcattcaccgagatgatcaagatgattcgagtgcggcacaac
aatgtggtgcccaccatggcgttgggtgtgcggcagctgaagaaagacctgggtggcaca
aaggcctttccccctggcattgatgagatccatcagttcctcgaccgcttctacatgtca
aggattgggatccgcatgctgatagggcagcatgttgctttgcatgagcctgatccagaa
cctggtgttattggactcataagcaaaagattatcccccatgctggtggctcaacatgct
actgaagatgcacgtgctatttgcatgagggaatatggatcagcccctgatgtgaacata
tatggagacccagatttcacatttccatatgttaaactacatctacaactgatgatgttt
gaattggtgaagaattccctccgtgcagtacaggaacgatatatgaactctgataagcat
gcgcctcctgttagaatcatagtcgctgatggagcagaggacgtaacaatcaagattagt
gatgaaggtggtggaatacccagaagtggtctctcgagaattttcacatatctctacagc
acagcagaaaacccacctgatctggatggccgtaacgaaggagtgaccatggccgggtac
ggctatgggatcccgattagccgtctttatgctcgatattttggcggggacctgcagatc
atttctatggaaggatatggaaccgatgcttacctccacctatcacggctaggagattcg
gaggagcccttgcattag

DBGET integrated database retrieval system