KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0381000-01Help
Entry
Os03t0381000-01   CDS       T02163                                 

Gene name
Os03g0381000
Definition
Similar to Aldose 1-epimerase-like protein.
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os03t0381000-01 (Os03g0381000)
   00052 Galactose metabolism
    Os03t0381000-01 (Os03g0381000)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Os03t0381000-01 (Os03g0381000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:complement(join(15102167..15102380,15101811..15101860,15100751..15101617))
AA seq 376 aa AA seqDB search
MAATSARSVAWQWLAVAAAVAAASLIGGTPAEARRGGKESIGFYELRRGEFSVVVTNWGA
TILTVNLPDKNGHIDDVVLGYKDIGSYVNDTTYFGALVGRVANRIAGGRFTVKGHAFHTY
KNDGKNTLHGGHRGFNQVFWSVRERATGHFPYITFYYRSYDGEQGFPGALDVLVTYKIDG
DYSFSVTMYARPVDDGKPTPVNLAQHTYWNLRGHGNGTILDHSVQIFASAVTPVGAGLIP
TGAVSPVSGTPFDFRAPAPPGARIADVPGGGYDINYVLDGEADGQGVRKAAVVSEPTSGR
VLELWSDQPGLQFYTGNFLKGDEGKGGARYVKHGGLCLETQDYPDAVHNAKFPTEIYRKG
QEYKHYMLYKFSLAKK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacgagcgccaggagcgtggcgtggcaatggttggccgtggcggcggcggtg
gcggcggcgtctctgatcggcggcacgccggcggaggcgaggaggggagggaaggagtcc
atcggtttctacgagctgcgtcggggcgagttctccgtcgtcgtcaccaactggggcgcc
accatcctcaccgtcaacctccccgacaagaacgggcacattgatgacgtcgttcttggc
tacaaagatattggatcttacgtgaatgacacgacctacttcggggcgctggtggggcgg
gtggcgaaccggatcgccggcgggaggttcacggtgaaggggcatgcgttccacacgtac
aagaacgacggcaagaacacgctccacggcggccaccgcgggttcaaccaggtgttctgg
tcggtccgggagagggccaccggccacttcccctacatcaccttctactaccggagctac
gacggcgagcagggcttcccgggcgccctcgacgtgctcgtcacctacaagatcgacggc
gactactccttcagcgtcaccatgtacgcccgccccgtcgacgacggcaagcccacgccg
gtcaacctcgcccagcacacctactggaacctccgcggccacggcaacggcaccatcctc
gaccactccgtccagatcttcgcgtcggcggtcacccccgtcggcgccggcctcatcccc
acgggagccgtctcgcccgtctccggcacgccgttcgacttccgcgcccccgcgccgccc
ggcgcgcgcatcgccgacgtccccggcggcgggtacgacatcaactacgtgctcgacggc
gaggccgacgggcagggcgtgcgcaaggcggcggtggtgagcgagcccacctcggggcgc
gtgctggagctgtggtccgaccagcccgggctgcagttctacacgggcaacttcctcaag
ggcgacgagggcaagggcggcgcgcgctacgtgaagcacggcggactctgcctcgagacg
caggactacccggacgccgtccacaacgccaagttccccaccgagatctaccgcaagggc
caggagtacaagcactacatgctctacaagttctctctcgccaagaagtag

DBGET integrated database retrieval system