KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0563300-01Help
Entry
Os03t0563300-01   CDS       T02163                                 

Gene name
Os03g0563300
Definition
Similar to Mg-chelatase subunit (Fragment).
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Os03t0563300-01 (Os03g0563300)
Enzymes [BR:dosa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Os03t0563300-01 (Os03g0563300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:complement(join(20249830..20249941,20249637..20249716,20248500..20249555))
AA seq 415 aa AA seqDB search
MASAFSPATAAPAASPALFSASTSRPLSLTAAAAAVSARIPSRRGFRRGRFTVCNVAAPS
ATQQEAKAAGAKESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTV
RSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRERVLEGEKLPVVTAKITMVDLPLGATE
DRVCGTIDIEKALTDGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTV
EREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFD
RDPKAFRESYLEEQDKLQQQISSARSNLGAVQIDHDLRVKISKVCAELNVDGLRGDIVTN
RAAKALAALKGRDTVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFT
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgccttctcccccgccaccgccgcgcccgccgcgtcgccggccctcttctcc
gcctccacctcccggcctctctccctcaccgccgccgccgctgccgtctcagcccgtatc
ccgtcacggagagggttccgccgcggccgcttcaccgtctgcaatgtagccgccccctcc
gccacccagcaggaggctaaggcggcgggcgcgaaggagagccaacggccggtgtatccg
ttcgcggcgatcgtggggcaggacgagatgaagctgtgcctgctgctcaacgtcatcgac
cctaagatcggcggtgtcatgatcatgggagaccgtggcaccggcaaatccaccaccgtc
cgctcgctcgtcgacctgctcccggatatccgcgtcgttgttggcgaccctttcaattcc
gaccctgacgatcccgaggtcatgggccctgaggtccgggaacgcgtgctggagggtgag
aagcttcctgttgtcacggccaagatcaccatggtagatcttccccttggtgccactgag
gatagagtctgtggcaccattgatattgagaaggcgctcaccgatggtgtcaaggcgttc
gagcctggtttgcttgccaaggccaacagggggattctttatgtggatgaggtcaatttg
ttggatgaccatctagtagatgtgcttctggattctgctgcgtcaggatggaacaccgtg
gagagagagggtatctccatctcccaccctgctcggttcatcctcattgggtctggtaac
cccgaggaaggggagctccggccacagctgcttgaccggtttggcatgcacgcgcaggtt
ggtactgtcagggatgctgaactcagggtgaaaattgttgaagagagagctcggttcgac
agggatccaaaggcgttccgtgagtcctacttggaggaacaagacaagctccagcagcag
atttcatctgctcggagtaaccttggtgctgtgcagattgaccatgatcttcgtgttaag
atttctaaagtgtgtgcagagttgaatgttgatggattaagaggggacattgtgactaac
agggctgccaaggcgttggcagcactcaaaggcagggacactgtcactgtagaggacatt
gccactgttatccccaactgcttgaggcatcggcttcggaaggacccacttgaatcaatt
gactcaggattgctcgtggttgagaagttttatgaagtcttcacctaa

DBGET integrated database retrieval system