KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0704400-01Help
Entry
Os03t0704400-01   CDS       T02163                                 

Gene name
Os03g0704400
Definition
Serine/threonine protein kinase domain containing protein.
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Os03t0704400-01 (Os03g0704400)
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Os03t0704400-01 (Os03g0704400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(28314542..28314743,28315053..28315481,28315639..28316408,28317648..28317839,28318718..28318879,28318997..28319467)
AA seq 741 aa AA seqDB search
MERRDNFLQPPAAAAAPAAGGGKGLPVPATGDATNLTSSSSSTSSLTLSPPDFLRQVQAA
LKRHRPTGSMQSNQPRATRVLVSRGEGSTKAVANPSVAQNPEGKVMQQRRGLLGASRLRN
AAPDQNKAVVSSQDELLLTTPLTLGTITDTHDQNGGQNHQPKSDTDLLVDRKKSSMEVSS
SQMASANALVGEDFKKDLFYLTSDPQLTSQRDNFPVAQVADDQGKNHKEIGIASAAVEMD
IKYDAANLSRRIDEACDQNHGEPMTRCSAMGSSVTAVSLYSGPTIQSKSAAQIDQYASPA
QMPQCGRESSGVSGHGSQKLHGVAMNHADCNTNKQQVDTNGGMDKPVSSSAVCLPSQGLS
GNDQSLSAKDDGAPRRSKVEKECRKKNYDPDVFFKVNGKLYQKLGKIGSGGSSEVHKVIS
AECTIYALKKIKLKGRDYPTAYGFCQEIEYLNKLKGKSNIIQLIDYEVTDKSLLQDDSLS
PRDGRIKDDHYIYMVLEYGEIDLANMVAQEWKKRNTSNMKIDENWLRFYWQQMLKAVNTI
HEERIVHSDLKPANFLLVRGALKLIDFGIAKAIMNDTTNIQRDSQIGTLNYMSPEAFMCN
EQDSGGNVIKCGRPSDIWSLGCILYQMVYGKTPFADYKNFWAKFKVVTDKNHKIKYEPVD
NPWLIDLMQRCLAWDRNDRWRIPQLLEHPFLVPLVPRDLPSIDQDPCRLLMERVRVHWAN
PKLHSFIAELEKDQCRPATQM
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggagaggagggataatttccttcagccccctgccgccgccgccgccccagccgccggc
ggcggaaagggcctcccggtccccgccacaggggacgcgacgaacctgacctcgtcgtcg
agctccacctcctccctcacgctgtcccctccggacttcctgcgtcaggttcaggccgcg
ctgaagcggcataggcctaccggttcgatgcagtccaatcaaccacgagcaacccgagtc
ctggtgtcccgaggtgagggctcaacgaaagctgttgccaacccttctgtggcacaaaat
ccggaaggcaaggttatgcagcagaggagaggcctgctgggggcttccaggttgcgaaat
gcagctcctgatcagaacaaagctgttgtctcaagtcaagacgaattgttgttgactacg
cctttgacattgggaactatcactgatacccatgatcagaatggtggtcagaaccaccag
ccgaaaagtgacactgatctcttggtggataggaagaaatcgtcaatggaagtttcttcc
tcccagatggcatccgcaaatgcattggtaggggaagatttcaaaaaagacctattctat
ttgactagcgatccgcagttaacttctcagagagataattttcctgtcgctcaagtagca
gatgatcaaggcaagaaccacaaggagattgggattgctagtgcagcagttgagatggat
atcaagtatgatgcagctaacttgtcccgaagaattgatgaggcttgtgatcagaatcat
ggagagccaatgactcgttgctctgccatgggttcatcagtgactgctgtatctttatat
tcagggcctactattcaaagtaaaagtgctgctcagattgatcaatatgcttcaccagct
cagatgccacaatgtggcagagaatcatctggtgtatcaggtcatggctctcaaaaactg
catggagtggcaatgaatcatgctgattgcaataccaacaaacagcaggttgataccaat
ggtgggatggacaaacctgtttctagtagtgcagtttgtttgccatcccaagggttatct
gggaatgatcaatctttgtctgccaaggatgatggtgctcctagacgaagcaaggttgaa
aaggagtgtcgcaaaaagaattatgatccggatgtattctttaaagtgaatggaaaactt
tatcagaagctaggtaaaatagggtctggaggcagcagtgaagttcacaaagttatatca
gccgagtgtacaatatatgccctgaaaaaaataaaacttaaaggtcgggactaccctact
gcctatggcttttgccaagaaattgagtacctaaacaagttgaaaggaaagagtaatatc
atacagttgattgattatgaggtcactgataaaagtttgcttcaagatgattcgctgtca
cccagagatgggagaattaaggatgatcactacatttatatggtccttgagtatggtgaa
attgatttagctaatatggttgctcaggagtggaagaagaggaacacctcaaatatgaaa
atagatgaaaattggctacgtttttattggcagcaaatgcttaaagctgtcaatacaata
catgaggaacggatagtgcactccgatttgaagcctgcaaattttttgcttgtgaggggt
gcactgaaacttattgactttggcattgctaaagcaataatgaatgataccacaaacatt
caacgtgattctcagattggaacactgaactatatgtcacctgaagcattcatgtgcaat
gagcaggactcgggtggtaatgttatcaagtgtggacgtccatctgatatttggtctctt
ggttgtattctttaccagatggtgtatggtaagacaccatttgctgattacaagaatttc
tgggccaagtttaaagttgttactgataagaaccacaagatcaagtatgaaccggtagat
aatccatggcttattgatttaatgcaacgatgccttgcatgggaccgaaatgatcgatgg
agaatacctcaattgcttgagcacccgttccttgttcctttggttccaagggatttacct
tcaattgaccaagacccgtgtaggttgctgatggagagggttagagttcactgggccaat
cccaagcttcatagttttattgcagagctcgagaaggatcaatgccgtccagccactcaa
atgtaa

DBGET integrated database retrieval system