KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0730000-01Help
Entry
Os03t0730000-01   CDS       T02163                                 

Gene name
Os03g0730000
Definition
Lecithin:cholesterol acyltransferase family protein.
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dosa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:complement(join(29846269..29846720,29845240..29846185))
AA seq 465 aa AA seqDB search
MVVGRPSSSSVARAVVLLAAAMLLSTLSPCCCASAGGGGGARRREKQQQLHPVILIPGAG
GNQLEARLTEEYAPSSLACRVWPVVRGRGGWFRLWFDPSVVVAPLTRCFADRMTLFYDSV
ADDYRNAPGVETRVSDFGSTSTLRYLDPNLKLLTGYMNVLASTLEKAGYEEGFDLFGAPY
DFRYGLAGPGHPSRVGSAYLERLRKLVESACAANGGRPAILVAHSLGGLYALQMVARSPP
AWRAANVKRLVTLSAPWGGSVQEMLTFASGNTLGVPFVDASLIRDEQRTAESNLWLLPAP
RVFGNTTLVVSRHHNRSYSAKNMTQFLRDIGFAEGVEPYRERIRPLVEVLPEPGVPVTCL
VGTGVDTVESLVYGEGGFEAGPEKVVYGDGDGTVNLDSLVGPIKAWSDSPEQVVEVVELP
EVSHSGILKDKSALDQILRIIDAINLNATTSSSSINRSSQDVLYN
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggggaggccgtcgtcatcatcggtggctcgtgcggtcgtgctcctcgcggcg
gccatgctgctgtccacgctgagcccgtgctgctgcgcgtcggcgggcggcggcggcggc
gcgcggcggcgtgagaagcagcagcagctgcacccggtgatcctgatccccggcgccggc
gggaaccagctggaggcgcggctgacggaggagtacgccccgtcgagcctcgcgtgccgc
gtgtggcccgtggtgcgcggccgcggcgggtggttccgcctctggttcgacccgtccgtc
gtcgtggcgccgctcaccaggtgcttcgccgaccggatgaccctcttctacgactccgtc
gccgacgactaccgcaacgctcccggcgtcgagaccagggtctccgacttcggctccacc
tccaccctccgctacctcgaccccaacctcaagttgctaacggggtacatgaacgtgttg
gcgagcacgctggagaaggcagggtacgaggaagggttcgacctgttcggcgcgccgtac
gacttccggtacgggctggccgggccggggcacccgtcgcgtgtgggcagcgcgtacctg
gagcggctgaggaagctggtggagtcggcgtgcgcggccaacggcgggaggccggcgatc
ctcgtggcgcacagcctgggcgggctgtacgcgctgcagatggtggcgcggagccccccc
gcgtggcgcgccgcgaacgtgaagcggctggtgacgctgtccgcgccgtggggcgggtcg
gtgcaggagatgctcaccttcgcgtcgggcaacaccctcggcgtgccgttcgtcgacgcg
tcgctcatccgcgacgagcagcgcaccgccgagagcaacctgtggctgctgccggcgccg
cgggtgttcgggaacaccacgctggtggtgtcgcggcaccacaaccggtcctactccgcc
aagaacatgacgcagttcctccgggacatcgggttcgccgaaggggtggagccgtaccgg
gagcggatacggccgctcgtcgaggtgctgccggagcccggggtgccggtgacgtgcctc
gtcggcacgggcgtcgacaccgtggagagcctcgtgtacggggagggcgggttcgaggcc
gggccggagaaggtggtgtacggcgacggcgacgggacggtcaacctcgacagcctcgtc
gggccgatcaaggcgtggtccgactcgccggagcaggtggtggaggtggtcgagctgccc
gaggtgtcgcactccggcatcctcaaggacaagagcgcgctcgaccagatcttgaggatc
atcgacgccatcaatctgaacgccacgacctcaagctcctccatcaatcgatcgtctcag
gatgttttgtacaattag

DBGET integrated database retrieval system