KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0730000-01Help
Entry
Os03t0730000-01   CDS       T02163                                 

Gene name
Os03g0730000
Definition
Lecithin:cholesterol acyltransferase family protein.
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Os03t0730000-01 (Os03g0730000)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Os03t0730000-01 (Os03g0730000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:complement(join(29846269..29846720,29845240..29846185))
AA seq 465 aa AA seqDB search
MVVGRPSSSSVARAVVLLAAAMLLSTLSPCCCASAGGGGGARRREKQQQLHPVILIPGAG
GNQLEARLTEEYAPSSLACRVWPVVRGRGGWFRLWFDPSVVVAPLTRCFADRMTLFYDSV
ADDYRNAPGVETRVSDFGSTSTLRYLDPNLKLLTGYMNVLASTLEKAGYEEGFDLFGAPY
DFRYGLAGPGHPSRVGSAYLERLRKLVESACAANGGRPAILVAHSLGGLYALQMVARSPP
AWRAANVKRLVTLSAPWGGSVQEMLTFASGNTLGVPFVDASLIRDEQRTAESNLWLLPAP
RVFGNTTLVVSRHHNRSYSAKNMTQFLRDIGFAEGVEPYRERIRPLVEVLPEPGVPVTCL
VGTGVDTVESLVYGEGGFEAGPEKVVYGDGDGTVNLDSLVGPIKAWSDSPEQVVEVVELP
EVSHSGILKDKSALDQILRIIDAINLNATTSSSSINRSSQDVLYN
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggggaggccgtcgtcatcatcggtggctcgtgcggtcgtgctcctcgcggcg
gccatgctgctgtccacgctgagcccgtgctgctgcgcgtcggcgggcggcggcggcggc
gcgcggcggcgtgagaagcagcagcagctgcacccggtgatcctgatccccggcgccggc
gggaaccagctggaggcgcggctgacggaggagtacgccccgtcgagcctcgcgtgccgc
gtgtggcccgtggtgcgcggccgcggcgggtggttccgcctctggttcgacccgtccgtc
gtcgtggcgccgctcaccaggtgcttcgccgaccggatgaccctcttctacgactccgtc
gccgacgactaccgcaacgctcccggcgtcgagaccagggtctccgacttcggctccacc
tccaccctccgctacctcgaccccaacctcaagttgctaacggggtacatgaacgtgttg
gcgagcacgctggagaaggcagggtacgaggaagggttcgacctgttcggcgcgccgtac
gacttccggtacgggctggccgggccggggcacccgtcgcgtgtgggcagcgcgtacctg
gagcggctgaggaagctggtggagtcggcgtgcgcggccaacggcgggaggccggcgatc
ctcgtggcgcacagcctgggcgggctgtacgcgctgcagatggtggcgcggagccccccc
gcgtggcgcgccgcgaacgtgaagcggctggtgacgctgtccgcgccgtggggcgggtcg
gtgcaggagatgctcaccttcgcgtcgggcaacaccctcggcgtgccgttcgtcgacgcg
tcgctcatccgcgacgagcagcgcaccgccgagagcaacctgtggctgctgccggcgccg
cgggtgttcgggaacaccacgctggtggtgtcgcggcaccacaaccggtcctactccgcc
aagaacatgacgcagttcctccgggacatcgggttcgccgaaggggtggagccgtaccgg
gagcggatacggccgctcgtcgaggtgctgccggagcccggggtgccggtgacgtgcctc
gtcggcacgggcgtcgacaccgtggagagcctcgtgtacggggagggcgggttcgaggcc
gggccggagaaggtggtgtacggcgacggcgacgggacggtcaacctcgacagcctcgtc
gggccgatcaaggcgtggtccgactcgccggagcaggtggtggaggtggtcgagctgccc
gaggtgtcgcactccggcatcctcaaggacaagagcgcgctcgaccagatcttgaggatc
atcgacgccatcaatctgaacgccacgacctcaagctcctccatcaatcgatcgtctcag
gatgttttgtacaattag

DBGET integrated database retrieval system