KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0736300-01Help
Entry
Os03t0736300-01   CDS       T02163                                 

Gene name
Os03g0736300
Definition
Similar to CEL6%3DCELLULASE 6 (Fragment).
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os03t0736300-01 (Os03g0736300)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Os03t0736300-01 (Os03g0736300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:complement(join(30184489..30184864,30183760..30184067,30183151..30183615,30182775..30182910,30182525..30182697,30182030..30182434))
AA seq 620 aa AA seqDB search
MFGRDPWGGPLEISNADSATDDDRSRDLDRGALMRQLDETQQSWLLAGPGDQAGKKKKKY
VDLGCMVLDRKIFMWTVGTILGVGLFIGFVMMIVKLVPHKRPPPPPPDQYTQALHKALMF
FNAQRSGPLPKHNGVSWRGNSCMKDGLSDSTVRKSLVGGFYDAGDAIKFNYPMAWSMTML
SWSVIEYKAKYEAIGELDHVKELIKWGTDYLLKTFNSSADTIDRIVAQVGVGDTSKGGAQ
PNDHYCWMRPEDIDYPRPVTECHSCSDLASEMAAALAAASIVFKDSKTYSDKLVRGAKAL
YKFGRLQRGRYSPNGSDQAIFYNSTSYWDEFVWGGAWMYFATGNNTYLSVATAPGMAKHA
GAYWLDSPNYGVFTWDDKLPGAQVLLSRLRLFLSPGYPYEEILRTFHNQTDNVMCSYLPM
YNSFNFTKGGMIQLNHGRPQPLQYVVNAAFLASLYSDYLDAADTPGWYCGPTFYTTEVLR
KFARSQLDYVLGKNPLKMSYVVGFGNKYPKRAHHRGASIPHNGVKYGCKGGFKWRETKKP
NPNILIGALVAGPDRHDGFKDVRTNYNYTEPTLAANAGLVAALISLTNIHVKSGIDKNTI
FSAVPPMFPTPPPPPSAWKP
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgttcgggcgggacccgtggggcgggccgctggagatctcgaatgcggactcggcgacg
gacgacgaccggagccgggacctggacaggggggcgctgatgcggcagctggacgagacg
cagcagagctggctcctggccgggccgggcgaccaggccggcaagaagaagaagaagtac
gtcgacctcggctgcatggtcctcgaccgcaagatcttcatgtggaccgtcggcaccatc
ctcggcgtcggcctcttcatcggcttcgtcatgatgatcgtcaagctcgtcccccacaag
cgcccccctcctcctccccccgaccagtacacccaggccctccacaaggccctcatgttc
ttcaacgcgcaacgatctggtccgctgccgaagcataacggcgtcagctggagggggaat
tcttgcatgaaggatggcctctccgacagcaccgtccggaagagcttggtcggaggcttc
tacgacgcaggagacgccatcaagttcaactaccccatggcctggtccatgaccatgctc
agctggagtgtgatcgagtacaaggccaagtatgaggcgatcggtgagctcgaccatgtc
aaggagctgatcaagtggggcacagattacctcctcaagaccttcaattcatcagccgat
actatcgatcggatcgtcgcacaggtgggtgtaggtgacacctcaaaaggtggtgcccaa
cctaatgaccactactgctggatgaggccagaggatatcgattaccccagacctgtcact
gagtgccactcttgctcagatcttgcttccgaaatggctgctgcccttgctgcagcttcc
atagtgttcaaggacagcaagacttactctgacaagctcgtgcgtggcgcaaaggccctg
tacaagttcggtaggctgcagcgtgggagatacagccccaatggctctgatcaagcaatt
ttctacaattccaccagttactgggatgagtttgtgtggggtggtgcgtggatgtacttt
gccacagggaacaatacatacctatcggttgcaacagctccggggatggcaaagcatgct
ggagcatactggctcgatagtccgaattatggagtttttacctgggatgacaagcttcca
ggagctcaggttcttctgagcaggttgcggcttttcctaagtcctggatatccttacgaa
gaaatactgagaacatttcacaaccaaacagacaatgttatgtgctcgtatctgccgatg
tacaattcattcaactttaccaaaggaggaatgatacagctcaaccacggaaggcctcag
ccacttcagtatgttgtcaatgcggctttccttgcctctctatacagcgattacctggat
gctgcagatacacctgggtggtattgtggacctactttctacactacagaagtcctccgc
aaatttgcaaggtcacagctcgattatgtcctaggtaagaacccactgaagatgagctac
gttgtgggttttggaaacaagtaccccaagcgcgctcatcacagaggtgcatcaatccct
cataatggtgtcaaatatggatgcaaaggaggctttaaatggagggagactaagaagcca
aatcctaatatccttattggagcactggttgctggccctgataggcatgatggcttcaaa
gatgtccgtacaaactacaattacacggagcctactcttgcagcaaatgctggcctggtg
gcagccttgatttccctaactaacattcacgtcaaaagtggaatcgataagaacaccatc
ttctctgcagttcctccgatgtttccaactcccccacctccaccgtcagcttggaaacca
tga

DBGET integrated database retrieval system