KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0737600-01Help
Entry
Os03t0737600-01   CDS       T02163                                 

Gene name
Os03g0737600, CYCH;1, CYCLIN-H-1
Definition
Cyclin H-1.
Orthology
K06634  
cyclin H
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dosa03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dosa03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr03:join(30236147..30236206,30236316..30236366,30236462..30236534,30236766..30236884,30236967..30237040,30237232..30237352,30237433..30237501,30237666..30237707,30238526..30238603,30239575..30239633,30239711..30239795,30240094..30240182,30240272..30240334,30240410..30240419)
AA seq 330 aa AA seqDB search
MADFRTSTHRERWIFQTNDLMDRWGAANQRATETLVQYGTTRLKVDPVDGSLSYPEPAPD
HVVGSSGVKPLSCEEERLMRVFYEQKIQEVCSAFKFPHKIQATAIIYFKRFYLQWSVMEH
HPKHIMLTCIYSSCKVEENHVSAEELGKGIQQDHQIILNNEMIVLKSLDFDLIVYAPYRS
IEGFVDDMEDFCRAGNGEHQRLQDLRQTAISQVDKMMLTDAPLLYTPGQLALAALHKSND
MHKILNFERYLESVFSRQHSDCPIEQFVGSINMINYLVEQLKIPTPKDMRHIDRKLKHCL
DPSSQDEHKKKEKKSKHKSKRAANEAQLDS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttccggacctccacgcatcgggagaggtggatcttccagacgaacgatctg
atggatagatggggggcggcgaaccagcgggccacggagacgctcgttcagtatggaacg
acgcggttgaaggtggaccctgttgatgggtcgctgtcgtacccggaacctgcgcctgat
catgttgtagggagctcaggtgtaaagcctctgtcttgtgaagaggagcgattgatgcgg
gtattttatgagcaaaagattcaagaagtatgttcagcatttaagttccctcacaaaatc
caggctaccgcaataatatatttcaagagattttatctgcaatggtctgtaatggaacat
cacccaaagcatattatgttaacttgtatttattcttcttgcaaagtggaagaaaatcat
gtttctgctgaggaacttggtaaaggaattcaacaggaccaccagattattctaaataac
gagatgattgttctcaaatctttagattttgatctgattgtttatgctccgtatcgatct
atcgaaggatttgttgatgacatggaggatttctgcagagcaggtaatggtgagcaccaa
cggttgcaggatttacgtcaaactgcgatatctcaggttgacaaaatgatgttgactgac
gctcctcttctctacactcctggacagttggctctggctgctttgcacaaatccaatgat
atgcacaagatccttaattttgaaaggtacttggaaagtgttttttcaaggcaacattct
gattgtccaatcgaacaatttgttgggtcaatcaatatgatcaattatttggttgagcag
cttaaaatacctactcctaaggacatgaggcatattgaccgcaagcttaagcattgtttg
gatccaagctcacaggatgagcataagaagaaagagaagaagtcgaagcacaaatcaaaa
agggcagctaatgaagcccaacttgacagctag

DBGET integrated database retrieval system