KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0740800-01Help
Entry
Os03t0740800-01   CDS       T02163                                 

Gene name
Os03g0740800
Definition
DNA double-strand break repair and VJ recombination XRCC4, C-terminal domain containing protein.
Orthology
K10886  
DNA-repair protein XRCC4
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Os03t0740800-01 (Os03g0740800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr03:join(30395717..30396025,30397125..30397253,30397438..30397560,30397854..30398117)
AA seq 274 aa AA seqDB search
MATSTAAPRHSCAKLSVAVEDPKAGGGGAVFVKATWHPTRFSLAVTDGGAAWVAQASDAE
VRLRAEQWDQPVADYLALAERYLAFQQPSSTYSFHDAANGNRRLSWTFEKQGTKLEWRWK
LQPAPNTQQTIAEILDFLMDANIRLSEEVVRKTQSFDKLKQESEKCLQQSERFNIEKAEF
EQSTFSKFVAVLNSKKAKLRQLKDKLTEFESADKAPKEEDENSTDKTELFEEASDKDASV
NDEPSETGGGDLHSSPEKTAATSRGGRGRKRTRK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctcgacggcggcgcccaggcacagctgcgcgaagctctcggtggcggtggag
gaccccaaggcgggcggcggcggagccgtcttcgtgaaggccacgtggcaccccacgcgc
ttctccctcgccgtcaccgacggcggcgccgcgtgggtcgcccaggcctccgacgccgag
gtgcgcctccgcgccgagcagtgggaccagcccgtcgccgactacctcgccctcgccgag
cgctacctcgccttccagcagccctcctccacctactccttccacgacgccgccaacggc
aatcgaaggctgtcatggacatttgagaaacaaggcaccaagttagaatggcgatggaaa
ctgcagcctgcacctaacactcagcagactatagctgagatcttggattttcttatggat
gcaaatatacgcttgagcgaagaggttgttaggaaaacacaatcctttgacaagttgaaa
caagaatctgagaagtgcttgcaacaaagtgaaagatttaacattgagaaagctgagttc
gaacaatccacattttcaaagtttgtggctgtcttaaattcgaagaaagccaagctcaga
caactcaaggacaaactcacagaatttgaatctgctgacaaggctccaaaggaggaggat
gagaactccactgataagacagagctttttgaggaagcaagtgacaaagatgcaagcgtt
aatgatgaaccctctgagactggtggcggcgatcttcatagctctcctgagaaaactgca
gccacctccagaggggggaggggtcgcaagaggactagaaaatag

DBGET integrated database retrieval system