KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0797000-01Help
Entry
Os03t0797000-01   CDS       T02163                                 

Gene name
Os03g0797000
Definition
Similar to Indole synthase.
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dosa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dosa00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:dosa00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:complement(join(33197821..33197910,33196946..33197092,33196685..33196859,33195930..33196006,33195678..33195755,33195214..33195291,33195033..33195092,33194818..33194952))
AA seq 279 aa AA seqDB search
MEMEDSGRGVVGAGKRGVAETFSRLREQGKTAFIPFITASDPDLATTSKALKILDSCGSD
VIELGVPYSDPLADGPVIQAAATRALKKGATFDSVIAMLKGVIPELSCPIVIFTYYNPIL
KRGVSNFMAIIKQAGVHGLVVPDLPLEETALLRNEAVMHGIELVLLTTPTTPTERMKEIA
KASEGFIYLVSSVGVTGARSNVNLRVEYLLQEIKKVTDKPVAVGFGISTPEHVKQIAGWG
ADGVIIGSAIVRQLGEAASPEEGLKRVEEYAKNMKAAMP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaagatagcggtcgcggcgtcgtgggcgccgggaagcgcggcgtcgcggag
accttctccaggctccgggagcagggcaagactgcattcattccattcatcaccgccagt
gaccctgacttggcaaccacatcgaaagcgttgaagatccttgattcctgtggttcagat
gtgattgagctgggtgtaccttactcggatccgttggctgatgggccggttattcaggct
gcagcaacgcgtgctcttaagaaaggcgctacatttgattccgtcatagctatgctcaag
ggggttatacctgagttgtcttgtccaatagttatcttcacatactacaacccaatttta
aagcgcggagtgagtaacttcatggctatcattaaacaagccggcgtacatggtcttgta
gtacctgatcttcctttggaagagacagcgctgttgaggaatgaggctgtcatgcatggc
atagagctggtgctgcttacaacaccaaccacaccaacagagaggatgaaggagattgca
aaagcttcagaaggatttatttatcttgtaagttctgttggagttacaggtgcacgctca
aatgtaaatttgcgtgttgagtaccttcttcaggagatcaagaaggttacagacaaacct
gttgctgttggctttggcatatcgactccagagcatgtaaagcagattgcaggctgggga
gcagatggtgtgatcatcggcagcgctattgttagacagttaggagaggctgcttcacct
gaagaagggttgaaaagagtagaagagtatgccaagaacatgaaggctgctatgccttga

DBGET integrated database retrieval system