KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0811100-01Help
Entry
Os03t0811100-01   CDS       T02163                                 

Gene name
Os03g0811100
Definition
Similar to Magnesium-chelatase subunit chlD, chloroplast precursor (EC 6.6.1.1) (Mg-protoporphyrin IX chelatase) (Mg-chelatase subunit D).
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dosa00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr03:join(33955317..33955577,33956404..33956582,33956756..33956840,33956920..33957236,33957397..33957520,33958224..33958316,33958710..33958805,33959119..33959268,33959342..33959539,33959827..33959982,33960130..33960237,33960406..33960540,33960623..33960778,33960958..33961078,33961596..33961681)
AA seq 754 aa AA seqDB search
MAMATTALSASLPRLLPPRRRRFPTPSSSSPSAASTSTSRVVRLRAAAASAPSEVLDSTN
GAIPSGKGGGGQQYGREYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGTAKTVMA
RGLHAMLPPIEVVVGSIANADPNYPEEWEEGLANQVQYDADGNLKTEIIKTPFVQIPLGI
TEDRLIGSVDVEASVKSGTTVFQPGLLAEAHRGVLYVDEINLLDEGVSNLLLNVLTEGVN
IVEREGISFRHPCKPLLIATYNPEEGSVREHLLDRIAINLSADLPMSFDDRVAAVDIATQ
FQESSKEVFKMVEEETEVAKTQIILAREYLKDVAISTEQLKYLVMEAIRGGCQGHRAELY
AARVAKCLAAMEGREKVYVDDLKKAVELVILPRSILSDNPQEQQDQQPPPPPPPPPPQDQ
DSQEDQDEDEEEDQEDDDEENEQQDQQIPEEFIFDAEGGIVDEKLLFFAQQAQRRRGKAG
RAKNLIFSSDRGRYIGSMLPKGPIRRLAVDATLRAAAPYQKLRREKDRDKTRKVFVEKTD
MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDFA
EVLLPPSRSIAMARNRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVGRIMIVAITDGR
ANVSLKKSTDPEATSDAPRPSSQELKDEILEVAGKIYKAGISLLVIDTENKFVSTGFAKE
IARVAQGKYYYLPNASDAVISAATKTALSDLKSS
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggccaccaccgcgctctccgcctccctcccgcgcctactcccgcctcgccgc
cgccgcttcccgacgccctcctcctcctccccctccgccgcatccacctccacctcccgc
gtcgtccgcctgcgggccgccgcggcctcggcgccatccgaggtcctcgactccaccaac
ggggccatcccctcggggaagggcggcggcgggcagcagtacgggagggagtatttcccc
ttggccgctgtcgtcgggcaggatgcaattaaaactgctctgctgcttggggcaattgac
cgtgaaattggaggcatcgccatctcagggaagcgtgggacagcaaagacagtgatggct
cgtggcttgcacgctatgcttccacctattgaagtggttgtaggctcgattgcaaatgct
gaccctaactacccagaagaatgggaggagggtttggctaaccaagttcaatatgatgct
gatggtaacttgaagaccgagattatcaaaacaccttttgtgcagatcccgcttggtatc
actgaggataggttaatcggatcagtcgatgttgaagcatctgtgaaatcaggaactact
gtgtttcaacctggccttcttgctgaagctcacagaggcgttctttatgttgatgagata
aatctattggatgagggcgtaagcaatctacttctgaatgtcttgactgagggagtcaat
attgtggaaagagagggcattagctttcgtcatccatgcaaaccacttctaattgctact
tacaacccagaggaaggatctgtacgtgaacacttacttgatcgtattgcaattaattta
agcgctgatctgccaatgagttttgatgatcgtgtggcagctgtggatattgcaacacaa
tttcaagagtccagcaaagaggtttttaaaatggtggaagaagaaactgaggttgcaaaa
acccagataattttggcaagagaatatctgaaagatgttgcaatcagcacagagcagctc
aaatatcttgtcatggaagctatacgcggtggctgtcaggggcaccgggctgagctgtat
gctgctcgagtggcaaaatgtcttgctgctatggaagggcgtgaaaaagtatatgtggat
gaccttaagaaagctgtagagctagttattctacctcgatcaatcctatctgataaccca
caggagcagcaagaccaacaacctcctccacccccaccgccaccccctccacaagatcaa
gattctcaagaagatcaagatgaagacgaggaagaggaccaagaggacgatgatgaagaa
aatgaacagcaggaccagcagatacctgaggagttcatttttgatgctgaaggtggtata
gtagatgagaagctccttttctttgctcagcaagctcaaagacggcgagggaaagctgga
cgagcaaagaatctcatattctcatctgataggggacgatacataggttctatgcttccc
aagggtccaataaggaggttagctgttgatgccacacttcgagcagctgcaccataccag
aaactgaggagagagaaagatcgtgacaagacaagaaaggtttttgttgaaaaaactgac
atgagagccaaaagaatggctcgaaaagcaggcgcactggtcatatttgttgtggatgct
agcggtagcatggctctgaatcgcatgcagaatgcgaaaggtgcagcattaaagttgctt
gcagaaagctacacaagcagagatcaggtttcaatcattccatttcgtggagattttgct
gaggttcttcttccaccttcaagatccatagcaatggcccgcaatcgtcttgagaagcta
ccatgtggtggcggttctcctttagctcacggccttagcacagctgtcagagtgggtttg
aatgctgaaaagagcggtgatgttggacgtatcatgattgttgcaatcaccgatggaaga
gctaatgtgtcactgaagaaatcgactgacccagaagccacttcagatgctccaagacct
tcttctcaagaattaaaggatgagatacttgaggtggctggcaaaatatacaaggctgga
atttcacttcttgttattgataccgagaacaagtttgtatccacaggatttgccaaggaa
attgcaagggtcgcccaaggtaaatactattacctgccgaatgcttcagacgctgttatt
tccgccgccaccaagactgcactctcggacctgaagagttcgtga

DBGET integrated database retrieval system