KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0819600-01Help
Entry
Os03t0819600-01   CDS       T02163                                 

Gene name
Os03g0819600
Definition
Chalcone isomerase (EC 5.5.1.6).
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    Os03t0819600-01 (Os03g0819600)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     Os03t0819600-01 (Os03g0819600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr03:complement(join(34395485..34395581,34395226..34395387,34394926..34395149,34394626..34394844))
AA seq 233 aa AA seqDB search
MAAVSEVEVDGVVFPPVARPPGSGHAHFLAGAGVRGVEIAGNFIKFTAIGVYLEEGAAVP
ALAKKWAGKSADELAADAAFFRDVVTGDFEKFTRVTMILPLTGEQYSDKVTENCVAAWKA
AGVYTDAEGAAADKFKEAFKPHSFPPGASILFTHSPPGVLTVAFSKDSSVPEGAVAAAAI
ENRALCEAVLDSIIGEHGVSPAAKRSIAARVSQLLKAESTGDVAAAEPAPVSA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgtcggaggtggaggtcgacggcgtcgtgttcccgccggtggcccgcccg
ccgggctccggccacgcccacttcctcgccggcgcaggtgtgaggggagtggagatcgcc
ggcaacttcatcaagttcacggccatcggcgtgtacctggaggagggcgcggccgtgccg
gcgctggccaagaagtgggccggcaagtccgccgacgagctcgccgccgacgccgccttc
ttccgcgacgtcgtcaccggcgatttcgagaagttcacgagggtgacgatgatcctgccg
ctcaccggcgagcagtactcggacaaggtgacggagaactgcgtcgcggcgtggaaggcc
gccggcgtgtacacggacgccgagggcgcggccgcggacaagttcaaggaggccttcaag
ccccacagcttccctccgggcgcgtccatcctcttcacccactccccgcccggcgtcctc
accgtcgcgttctccaaggactcgtcggtgccagagggcgccgtggcggcggcggcgatc
gagaacagggcgctctgcgaggcggtgctggattccatcatcggcgagcacggggtctcg
ccggcggcgaagcggagcatagcggcccgcgtctcgcagctcctgaaggcggaatccacc
ggcgacgtggcggcggcggagcccgcgccggtgtccgcgtga

DBGET integrated database retrieval system