KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0106300-01Help
Entry
Os04t0106300-01   CDS       T02163                                 

Gene name
Os04g0106300
Definition
(RAP-DB) Similar to Arginase (EC 3.5.3.1).
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Os04t0106300-01 (Os04g0106300)
  Amino acid metabolism
   00220 Arginine biosynthesis
    Os04t0106300-01 (Os04g0106300)
   00330 Arginine and proline metabolism
    Os04t0106300-01 (Os04g0106300)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Os04t0106300-01 (Os04g0106300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(396689..396835,398236..398395,398484..398617,398836..399045,399358..399468,400309..400569)
AA seq 340 aa AA seqDB search
MGGVAAGTRWIHHVRRLSAAKVSADALERGQSRVIDASLTLIRERAKLKAELLRALGGVK
ASACLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSSTEEGKELNDPRVLTDVGDVPI
QEIRDCGVEDDRLMNVVSESVKTVMEEDPLRPLVLGGDHSISYPVVRAVSEKLGGPVDIL
HLDAHPDIYDAFEGNIYSHASSFARIMEGGYARRLLQVGIRSITKEGREQGKRFGVEQYE
MRTFSKDREKLESLKLGEGVKGVYISVDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNL
QGDVVAGDVVEFNPQRDTVDGMTAMVAAKLVRELTAKISK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgtggcggcgggcaccaggtggatccaccacgtccggcggctcagcgccgcc
aaggtgtcggcggacgccctggagcgcggccagagccgggtcatcgacgcctccctcacc
ctcatccgcgagcgcgccaagctcaaggcagagttgctgcgcgctcttggtggtgtgaaa
gcttcagcatgcctcttaggtgttcctcttggtcacaactcatcgttcttacagggacct
gcatttgctcctccccggataagggaagccatttggtgtggaagtaccaactctagcaca
gaagaaggcaaagaactcaatgatcctcgagtgctaacagatgttggtgatgtccccata
caagagattcgtgactgtggtgttgaagatgacagattgatgaatgttgtaagcgagtct
gtcaaaacagtgatggaggaagatcctcttcggccattggtcctgggaggcgatcactca
atatcttatccagttgttagggctgtgtctgaaaagcttggtggacctgttgacattctt
caccttgacgcacatccagatatctacgatgcttttgaaggaaacatctattcgcatgct
tcttcatttgcaagaataatggaaggaggttatgctaggaggcttctacaggttggaatc
agatcaattaccaaagaagggcgtgagcaggggaagagatttggtgtggaacagtatgag
atgcgcactttttcaaaagatagggagaagcttgaaagtctgaaacttggggaaggtgtg
aagggagtgtacatctcagttgacgtggactgcctcgatcccgctttcgcgccaggtgtc
tctcacattgagccaggaggcctctccttccgcgacgtgctcaacatcctccataacctg
caaggagatgttgtcgccggagatgtggtggagttcaacccgcagcgtgacacggtggac
gggatgacggctatggttgcagccaagctggtccgggagctcacagccaagatctccaag
tga

DBGET integrated database retrieval system