KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0106300-01Help
Entry
Os04t0106300-01   CDS       T02163                                 

Gene name
Os04g0106300
Definition
Similar to Arginase (EC 3.5.3.1).
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Os04t0106300-01 (Os04g0106300)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Os04t0106300-01 (Os04g0106300)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Os04t0106300-01 (Os04g0106300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(396689..396835,398236..398395,398484..398617,398836..399045,399358..399468,400309..400569)
AA seq 340 aa AA seqDB search
MGGVAAGTRWIHHVRRLSAAKVSADALERGQSRVIDASLTLIRERAKLKAELLRALGGVK
ASACLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSSTEEGKELNDPRVLTDVGDVPI
QEIRDCGVEDDRLMNVVSESVKTVMEEDPLRPLVLGGDHSISYPVVRAVSEKLGGPVDIL
HLDAHPDIYDAFEGNIYSHASSFARIMEGGYARRLLQVGIRSITKEGREQGKRFGVEQYE
MRTFSKDREKLESLKLGEGVKGVYISVDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNL
QGDVVAGDVVEFNPQRDTVDGMTAMVAAKLVRELTAKISK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgtggcggcgggcaccaggtggatccaccacgtccggcggctcagcgccgcc
aaggtgtcggcggacgccctggagcgcggccagagccgggtcatcgacgcctccctcacc
ctcatccgcgagcgcgccaagctcaaggcagagttgctgcgcgctcttggtggtgtgaaa
gcttcagcatgcctcttaggtgttcctcttggtcacaactcatcgttcttacagggacct
gcatttgctcctccccggataagggaagccatttggtgtggaagtaccaactctagcaca
gaagaaggcaaagaactcaatgatcctcgagtgctaacagatgttggtgatgtccccata
caagagattcgtgactgtggtgttgaagatgacagattgatgaatgttgtaagcgagtct
gtcaaaacagtgatggaggaagatcctcttcggccattggtcctgggaggcgatcactca
atatcttatccagttgttagggctgtgtctgaaaagcttggtggacctgttgacattctt
caccttgacgcacatccagatatctacgatgcttttgaaggaaacatctattcgcatgct
tcttcatttgcaagaataatggaaggaggttatgctaggaggcttctacaggttggaatc
agatcaattaccaaagaagggcgtgagcaggggaagagatttggtgtggaacagtatgag
atgcgcactttttcaaaagatagggagaagcttgaaagtctgaaacttggggaaggtgtg
aagggagtgtacatctcagttgacgtggactgcctcgatcccgctttcgcgccaggtgtc
tctcacattgagccaggaggcctctccttccgcgacgtgctcaacatcctccataacctg
caaggagatgttgtcgccggagatgtggtggagttcaacccgcagcgtgacacggtggac
gggatgacggctatggttgcagccaagctggtccgggagctcacagccaagatctccaag
tga

DBGET integrated database retrieval system