KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0271000-01Help
Entry
Os04t0271000-01   CDS       T02163                                 

Gene name
Os04g0271000
Definition
Similar to NAD-dependent deacetylase sirtuin-7 (EC 3.5.1.-) (SIR2-like protein 7). Splice isoform 2.
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Os04t0271000-01 (Os04g0271000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:complement(join(11328116..11328214,11327138..11327167,11326713..11326805,11325932..11326051,11324338..11324438,11324109..11324217,11323579..11323658,11321698..11321776,11319865..11319918,11319698..11319791,11319227..11319306,11317992..11318059,11317806..11317908,11316538..11316879))
AA seq 483 aa AA seqDB search
MSLGYAEKLSYREDVGNVGMPEIFDSPELLHKKIEELAVMVRESKHLVVFTGAGISTSSG
IPDFRGPKGVWTLQRSGKGVPGASLPFHRAVPTLTHMALVELEKTGRLKFVISQNVDSLH
LRSGLPREKLAELHGNSFKEICPSCKKEYLRDFEIETIGLKDTPRRCSDKNCGARLKDTV
LDWEDALPPEEMDAAKEQCQKADLVLCLGTSLQITPACNMPLLSLKNGGRVAIVNLQATP
KDKKASLVIHGLVDKVIAGVMYMMNLRIPPYIRTDFVQISLRNSVKKKCVRWTLRVTSIH
GLRAPLPFLRSVEVSFPERPDMKPVVLKEQPFSLQRETSMNRPFVMLLTFNFSDGCGCSS
SSIEWPVDFLKQKDSFVRDRSLVLQELQHAAEHRSRAGQHAILEREGVPRAETSIHALVT
NIVRYDTEDSKAAVPMATWMNSNGSLSKRHMDAIGCNPASSKKQKLVATRHRRKGLNPAT
QKV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttggctatgccgagaagctatcctaccgagaggatgtgggaaatgtcggcatg
cctgagatcttcgactctcctgaactcctccacaagaagatagaagagcttgcagtcatg
gtgcgagagagtaagcatttggtggtgtttactggagcaggcatatcaacttcatcaggc
atacctgacttccgagggcccaaaggcgtgtggacactgcagcgttcaggaaaaggtgtt
cctggtgcatcactgccgtttcaccgagctgttccaaccttgactcatatggcactggtt
gaattggaaaaaacaggacgattaaagtttgtcataagccagaatgttgatagcttacat
ctccgctctggcctcccaagggagaagctggctgaattgcatggaaattctttcaaggag
atctgcccaagctgtaaaaaggagtaccttcgtgattttgaaattgagacgataggactg
aaggatactccaaggcgttgttctgataagaactgtggagctagattaaaagacacagtt
cttgattgggaggatgctttaccccctgaggagatggatgctgccaaggagcagtgtcaa
aaagctgatcttgtcctatgtttaggaactagtctgcagattactcctgcttgtaatatg
cctctgttgtcactgaagaatggggggagggtggctattgtaaatcttcaggcaactccg
aaggataaaaaggcaagccttgtcattcatggacttgtggataaggtcattgctggggtt
atgtatatgatgaatctgcgtatccctccatatattcgtactgactttgttcaaattagt
ctccggaactcggtcaaaaaaaaatgcgtgagatggactctccgagtaacaagcattcat
ggcttgcgagcacctttgccatttcttcgatcagttgaggtttcctttcctgaaagacct
gacatgaagcctgtagtactaaaggagcaaccattttctttgcagagagaaacatcaatg
aatagaccgtttgtcatgctattgacattcaactttagtgatggttgcggctgttcgagc
tcttccattgaatggcctgttgattttctgaagcaaaaagacagctttgtcagggataga
agtctagtcctgcaagagttgcaacatgctgcagagcatcgatcacgtgcagggcagcat
gcaattctggagagggagggtgtgccaagagctgaaacgtcaattcatgcacttgtgacc
aacatcgtcaggtatgatactgaagatagcaaggcggcagttcccatggctacatggatg
aacagcaacggcagcctttcgaaacggcatatggatgccattggttgcaacccagcatcg
tcaaaaaagcagaagttggttgctactcgtcatcggcgaaagggcttgaaccctgctact
cagaaagtttga

DBGET integrated database retrieval system