KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0394200-01Help
Entry
Os04t0394200-01   CDS       T02163                                 

Gene name
Os04g0394200
Definition
(RAP-DB) Similar to 2-oxoglutarate dehydrogenase E2 subunit.
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00020  Citrate cycle (TCA cycle)
dosa00310  Lysine degradation
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Os04t0394200-01 (Os04g0394200)
  Amino acid metabolism
   00310 Lysine degradation
    Os04t0394200-01 (Os04g0394200)
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Os04t0394200-01 (Os04g0394200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N GCV_H PYNP_C
Motif
Other DBs
RAP-DB: Os04t0394200-01
Position
chr04:join(19378482..19378526,19379731..19379788,19379865..19379904,19380004..19380071,19380152..19380226,19380306..19380361,19380462..19380506,19380595..19380846,19380932..19381026,19381540..19381630,19381723..19381833,19381933..19382127,19382216..19382407)
AA seq 440 aa AA seqDB search
MASRIASRLLRRSNATLGLIRSYSHARNYSSQLSALIPIGSQSSKLTRRRYYLPNASPYQ
LWSRSFASDNGDQVEAVVPFMGESVTDGTLANFLKKPGDRVEADEPIAQIETDKVTIDVA
SPEAGVIEKFIASEGDTVTPGTKVAIISKSAAPAETHVAPSEDSTPKETPPKAEETKPKL
EEKSPKAEPPKMPLPPKTSPTEPQLPPKERERRVPMPRLRKRIANRLKDSQNTFAMLTTF
NEVDMTNLMKLRSDYKDEFVTKHGVKLGLMSCFVKAAVTALQNQPIVNAVIDGDDIIYRD
YVDISVAVGTSKGLVVPVIRDADNMNFADIEKGINALAKKATEGALSIDEMAGGTFTISN
GGVYGSLISTPIINPPQSAILGMHSIVQRPVVVDGNILARPMMYLALTYDHRLIDGREAV
YFLRRIKDVVEDPRRLLLDI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgcatcgcctctcgcctcctccgccgctccaacgcgactctaggcctcatc
aggagttattcacatgccaggaactacagcagtcaactttcagctcttattccaattggt
tcccagagctcaaagcttacaagaagacgctattacttgccaaatgcctctccgtaccaa
ctctggagtaggtcatttgcatctgacaatggagaccaggttgaagctgttgtccctttc
atgggtgaatctgtaactgatggaactcttgctaacttcttgaagaaacctggtgacaga
gttgaggctgatgagcccatagcacagattgaaactgataaggttactatagatgttgct
agtccggaagctggtgttattgaaaagttcattgctagcgaaggtgatactgttactcca
ggcaccaaagttgctatcatatcaaagtctgcggcaccagctgaaacacatgttgctccg
tctgaggattcaaccccaaaagaaacgcctccaaaagctgaggagacaaaaccaaaatta
gaagagaagtcaccaaaagcagaacctcccaagatgcctctgccacccaaaacctcccct
acagaaccacagctccctccaaaagaacgagaacggagggtgccaatgccaaggctcagg
aagcgtattgcaaaccgtttgaaggattcacaaaacacatttgcaatgctgaccacattt
aatgaagttgacatgactaatttgatgaagctgcggtctgattataaggatgagtttgtc
accaagcacggtgtcaaattgggtctgatgtcctgctttgtcaaggctgctgttacagca
cttcaaaaccaaccaattgtcaatgctgtcattgatggtgatgacatcatatacagagac
tatgttgacatcagtgttgctgttggtacttccaagggtcttgtggtgcctgttatccga
gatgctgataacatgaactttgcggacattgagaaagggataaacgcccttgcaaagaag
gctactgagggggcactctcaattgatgagatggcaggaggaacattcaccatctctaac
ggtggtgtttacggaagccttatcagcacacctatcatcaaccccccacagtctgctatt
cttggaatgcactccattgtacaacgccctgtggtcgtggacggcaacattctcgcgagg
ccaatgatgtaccttgcgctgacatatgaccacaggctgatcgacggcagagaagctgtc
tacttcctgcgccgcatcaaggacgtggttgaagacccacggagattgctcctcgacata
taa

DBGET integrated database retrieval system