KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0394200-01Help
Entry
Os04t0394200-01   CDS       T02163                                 

Gene name
Os04g0394200
Definition
Similar to 2-oxoglutarate dehydrogenase E2 subunit.
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os04t0394200-01 (Os04g0394200)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Os04t0394200-01 (Os04g0394200)
  Amino acid metabolism
   00310 Lysine degradation
    Os04t0394200-01 (Os04g0394200)
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Os04t0394200-01 (Os04g0394200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(19378482..19378526,19379731..19379788,19379865..19379904,19380004..19380071,19380152..19380226,19380306..19380361,19380462..19380506,19380595..19380846,19380932..19381026,19381540..19381630,19381723..19381833,19381933..19382127,19382216..19382407)
AA seq 440 aa AA seqDB search
MASRIASRLLRRSNATLGLIRSYSHARNYSSQLSALIPIGSQSSKLTRRRYYLPNASPYQ
LWSRSFASDNGDQVEAVVPFMGESVTDGTLANFLKKPGDRVEADEPIAQIETDKVTIDVA
SPEAGVIEKFIASEGDTVTPGTKVAIISKSAAPAETHVAPSEDSTPKETPPKAEETKPKL
EEKSPKAEPPKMPLPPKTSPTEPQLPPKERERRVPMPRLRKRIANRLKDSQNTFAMLTTF
NEVDMTNLMKLRSDYKDEFVTKHGVKLGLMSCFVKAAVTALQNQPIVNAVIDGDDIIYRD
YVDISVAVGTSKGLVVPVIRDADNMNFADIEKGINALAKKATEGALSIDEMAGGTFTISN
GGVYGSLISTPIINPPQSAILGMHSIVQRPVVVDGNILARPMMYLALTYDHRLIDGREAV
YFLRRIKDVVEDPRRLLLDI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgcatcgcctctcgcctcctccgccgctccaacgcgactctaggcctcatc
aggagttattcacatgccaggaactacagcagtcaactttcagctcttattccaattggt
tcccagagctcaaagcttacaagaagacgctattacttgccaaatgcctctccgtaccaa
ctctggagtaggtcatttgcatctgacaatggagaccaggttgaagctgttgtccctttc
atgggtgaatctgtaactgatggaactcttgctaacttcttgaagaaacctggtgacaga
gttgaggctgatgagcccatagcacagattgaaactgataaggttactatagatgttgct
agtccggaagctggtgttattgaaaagttcattgctagcgaaggtgatactgttactcca
ggcaccaaagttgctatcatatcaaagtctgcggcaccagctgaaacacatgttgctccg
tctgaggattcaaccccaaaagaaacgcctccaaaagctgaggagacaaaaccaaaatta
gaagagaagtcaccaaaagcagaacctcccaagatgcctctgccacccaaaacctcccct
acagaaccacagctccctccaaaagaacgagaacggagggtgccaatgccaaggctcagg
aagcgtattgcaaaccgtttgaaggattcacaaaacacatttgcaatgctgaccacattt
aatgaagttgacatgactaatttgatgaagctgcggtctgattataaggatgagtttgtc
accaagcacggtgtcaaattgggtctgatgtcctgctttgtcaaggctgctgttacagca
cttcaaaaccaaccaattgtcaatgctgtcattgatggtgatgacatcatatacagagac
tatgttgacatcagtgttgctgttggtacttccaagggtcttgtggtgcctgttatccga
gatgctgataacatgaactttgcggacattgagaaagggataaacgcccttgcaaagaag
gctactgagggggcactctcaattgatgagatggcaggaggaacattcaccatctctaac
ggtggtgtttacggaagccttatcagcacacctatcatcaaccccccacagtctgctatt
cttggaatgcactccattgtacaacgccctgtggtcgtggacggcaacattctcgcgagg
ccaatgatgtaccttgcgctgacatatgaccacaggctgatcgacggcagagaagctgtc
tacttcctgcgccgcatcaaggacgtggttgaagacccacggagattgctcctcgacata
taa

DBGET integrated database retrieval system