KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0404800-01Help
Entry
Os04t0404800-01   CDS       T02163                                 

Gene name
Os04g0404800
Definition
Similar to H0502B11.5 protein.
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os04t0404800-01 (Os04g0404800)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os04t0404800-01 (Os04g0404800)
   00620 Pyruvate metabolism
    Os04t0404800-01 (Os04g0404800)
   00640 Propanoate metabolism
    Os04t0404800-01 (Os04g0404800)
Enzymes [BR:dosa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Os04t0404800-01 (Os04g0404800)
Lipid biosynthesis proteins [BR:dosa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Os04t0404800-01 (Os04g0404800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(20078082..20078417,20078760..20078906,20079012..20079167,20079310..20079432,20079522..20079690,20079827..20079909,20080084..20080185,20080262..20080350,20080468..20080558,20080689..20080802,20081178..20081254,20081327..20081405,20081503..20081571,20081678..20081853,20081948..20082004,20082121..20082211,20082321..20082419,20082584..20082769)
AA seq 747 aa AA seqDB search
MAQLHIYASCGCARARAAIPLPAQAQASAAALPWVMSVTSPPLLRRGGWAMGASDHAAVA
AAASGNGKPRARRPSAAAAAVLGEPVAASDDHGLVHPSTDFASQALVSSTQQYQEMYRRS
IDDPAGFWSEIAETFYWKHKWNPDEVCTENLDVTKGPIKIEWFKGGKTNICYNAVDRNVE
AGDGEKIAMYWEGNEPGQDAKLTYSELLNKVCQLANYLKSVGVGKGDAVVIYLPMLMELP
IAMLACARIGAVHSVVFAGFSADALAQRIIDCKPKVVITCNAVKRGKKLIALKDIVDVSL
ADSAKNGVDVGISLTYENQSAMKREDTKWTSGRDVWWQDVVPNFPTKCDVEWVDAEDPLF
LLYTSGSTGKPKGVLHTTGGYMVYSATTFKHAFDYKPSDIYWCTADCGWITGHSYVTYGP
LLNGATVLVYEGAPNYPDPSRCWDVVDKYGVTIFYTAPTLIRALMRDGTEYVTRYSRKSL
RVLGSVGEPINPTAWRWFYDIIGDARCPISDTWWQTETGGFMITPLPGAWPLKPGSATFP
FFGVQPVIVDEKGKEMEGECSGYLCIKKSWPGAFRTLYGDKDRYETTYFKPFAGYYFSGD
GCSRDKDGYHFLTGRVDDVINVSGHRIGTAEVESALVSHPKCAEAAVVGIDHEVKGQGIY
AFVTLVDGVPYSDELRKSLVMTVRSQIGAFAAPDKIHWAPGLPKTRSGKIMRRILRKIAS
RQLDELGDTSTLAEPGVVDQLIALADS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgcatatatacgccagctgcggctgcgcacgcgcccgcgctgcgatcccg
cttcccgcgcaggctcaggcatccgctgcggctctaccttgggtgatgtccgtgacttcg
ccgccgctgctccggcgaggagggtgggcgatgggcgcgagcgatcacgccgcggtggcg
gcggcggcgagcggtaacggcaagccgcgggcgaggaggccctccgccgccgcggcggcc
gtgctgggcgagccggtggcggcgtccgacgaccacggcctcgtccaccccagcacggac
ttcgcctcccaggccctcgtctcctccacgcagcagtaccaagaaatgtaccgacgttcg
atcgacgatccggccgggttctggtcggagatcgcggagacgttctactggaagcacaag
tggaaccctgacgaggtctgcaccgagaatctggatgtcaccaaggggccgatcaagatc
gaatggttcaaagggggcaagaccaatatatgctacaatgcggtggaccgcaacgtggag
gctggcgacggcgagaagatagcgatgtactgggaagggaacgagcccggccaggacgcg
aagctcacctactccgagctcctgaacaaggtttgccagctggcaaattacctgaagagc
gtcggcgtcgggaagggtgatgccgtggtgatctacctgccgatgctgatggagctgccc
attgcgatgctcgcgtgtgctcggattggcgctgttcattcggttgtgtttgctggcttc
tctgctgacgcactagcacaaagaatcattgactgcaagcctaaggttgtgattacgtgc
aacgcggtgaaaaggggaaagaaactcatagctctcaaagatatagtagatgtgtcgctg
gctgacagtgcgaagaatggagtcgatgtaggcatttctttgacatacgaaaatcagtcg
gcaatgaagagagaagacacaaaatggacgtcaggcagagacgtttggtggcaggatgtt
gtgcccaattttccaacaaaatgtgatgtggaatgggtagatgcagaggatccattgttt
cttctatatacaagtggtagcacaggaaagccaaagggtgtattgcatacaacgggaggc
tatatggtgtactctgcaacaacatttaagcacgcatttgattacaagccatcagatata
tactggtgcactgcagactgtgggtggattactgggcatagttatgtgacatatggtcct
ctcctgaatggagccacagttcttgtttacgaaggggctccaaactatcctgatcctagt
cgttgttgggacgttgttgacaaatacggggtgacgatattttatactgcaccaacactt
attcgtgcactcatgcgtgatggtaccgagtatgttactcggtattctcgtaaatctctt
cgagttctaggaagcgtaggcgagccaatcaatcccactgcttggagatggttctatgat
attattggtgatgcaagatgcccaatatcagacacttggtggcagactgaaactggtggt
tttatgatcactcctttacctggcgcttggcctctgaaacccggatctgcgacatttcct
ttcttcggtgtacagccagtaatagtagatgagaaagggaaggaaatggaaggagaatgc
agcggatacctttgcataaagaagtcatggcctggggctttccggacactttatggagac
aaggacagatatgaaaccacatacttcaagccatttgctggctattacttctccggtgat
ggttgcagcagggacaaagatggataccattttctgactggacgggttgacgatgttatc
aatgtcagcggccaccggattgggacagcagaggttgagtctgctctggtttcacatcca
aaatgcgccgaggccgctgttgttggaattgaccatgaggttaaaggccagggaatttac
gctttcgtgacattggtggacggtgttccttacagcgatgagctacggaaaagcctcgtt
atgactgttcgcagccagattggggcgttcgcggcgccggacaagatccactgggcgccg
gggctcccgaagacgcggagcggcaagatcatgcggaggatcctgcggaagatcgcgtcc
aggcagctggacgagctcggcgacaccagcacgctcgccgaaccaggcgtcgtcgaccag
ctcatcgcgctcgccgatagctag

  All links  
No link information was found.   
DBGET integrated database retrieval system