KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0413500-01Help
Entry
Os04t0413500-01   CDS       T02163                                 

Gene name
Os04g0413500, GRAIN__INCOMPLETE_FILLING_1, GIF1
Definition
(RAP-DB) Similar to Cell wall invertase 2.
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Os04t0413500-01 (Os04g0413500)
   00500 Starch and sucrose metabolism
    Os04t0413500-01 (Os04g0413500)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Os04t0413500-01 (Os04g0413500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr04:join(20422222..20422426,20423070..20423078,20423566..20424446,20424836..20424997,20425749..20426008,20426117..20426207,20426494..20426682)
AA seq 598 aa AA seqDB search
MGVLGSRVAWAWLVQLLLLQQLAGASHVVYDDLELQAAATTADGVPPSIVDSELRTGYHF
QPPKNWINDPNAPMYYKGWYHLFYQYNPKGAVWGNIVWAHSVSRDLINWVALKPAIEPSI
RADKYGCWSGSATMMADGTPVIMYTGVNRPDVNYQVQNVALPRNGSDPLLREWVKPGHNP
VIVPEGGINATQFRDPTTAWRGADGHWRLLVGSLAGQSRGVAYVYRSRDFRRWTRAAQPL
HSAPTGMWECPDFYPVTADGRREGVDTSSAVVDAAASARVKYVLKNSLDLRRYDYYTVGT
YDRKAERYVPDDPAGDEHHIRYDYGNFYASKTFYDPAKRRRILWGWANESDTAADDVAKG
WAGIQAIPRKVWLDPSGKQLLQWPIEEVERLRGKWPVILKDRVVKPGEHVEVTGLQTAQA
DVEVSFEVGSLEAAERLDPAMAYDAQRLCSARGADARGGVGPFGLWVLASAGLEEKTAVF
FRVFRPAARGGGAGKPVVLMCTDPTKSSRNPNMYQPTFAGFVDTDITNGKISLRSLIDRS
VVESFGAGGKACILSRVYPSLAIGKNARLYVFNNGKAEIKVSQLTAWEMKKPVMMNGA
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcttggtagtagggtcgcttgggcatggctggtccagctgctgctgctccag
cagctcgccggagcgtcgcacgtcgtctacgacgacctcgagctgcaggcggctgctacc
acagcggacggcgtgccgccgtccatcgtcgactctgagctccggactgggtatcacttc
cagccacccaagaactggatcaatgatccgaacgcgccgatgtactacaaggggtggtac
catctgttctaccagtacaaccccaagggcgccgtgtgggggaacatcgtgtgggcgcac
tcagtgtcacgtgacctcatcaactgggtggcgctcaagccggccatcgagcccagcatc
agggccgacaagtacggctgctggtcggggtcggcgacgatgatggccgacgggacgccg
gtgatcatgtacaccggcgtcaaccgccccgacgtcaactaccaggtgcagaacgtggcg
ctgccgaggaacgggtcggacccgctgctgcgcgagtgggtgaagcccggccacaacccg
gtgatcgtgcccgagggcggcatcaacgcgacgcagttccgcgacccgaccaccgcgtgg
cgcggggccgacggccactggcggctgctcgtcggcagcctcgcggggcagtcccgcggc
gtggcgtacgtgtaccggagcagggacttccggcggtggacgcgcgcggcgcagccgctg
cactcggcgcccacggggatgtgggagtgcccggacttctacccggtcaccgcggacggc
cgccgcgagggcgtcgacacctcgtccgccgtcgtcgacgccgccgcctcggcgcgcgtc
aagtacgtgctcaagaacagcctcgacctgcgccggtacgactactacaccgtcggaacg
tacgaccggaaggccgagcggtacgtgccggacgaccccgccggcgacgagcaccacatc
cgctacgactacggcaacttctacgcctccaagacgttctacgacccggcgaagcgccgc
cgcatcctctggggatgggccaacgagtccgacaccgccgccgacgacgtggccaagggc
tgggccggaatccaggcgattccgaggaaagtgtggctggacccaagtgggaagcaactg
ttgcagtggccaatcgaggaggtcgagaggctgagagggaagtggccggtcattctcaag
gacagggtggtcaagccaggggaacacgtcgaggtgaccgggctacaaactgcacaggct
gacgtggaggtgagcttcgaggtggggagcctggaggcggcggagcggctggacccggcg
atggcgtacgacgcgcagcggctgtgcagcgcgcggggcgccgacgcgaggggcggcgtg
gggccgttcggcctgtgggtgctcgcgtccgcggggctggaggagaagaccgccgtgttc
ttcagggtgttcaggccggcggcgcgcggcggcggcgccggcaagcccgtcgtgctcatg
tgcaccgaccccaccaagtcatcgcgcaacccgaacatgtaccagccgacgtttgcaggg
ttcgttgacacggacatcaccaacgggaagatatctctgaggagcctgatcgacaggtcg
gttgttgagagcttcggggctggaggaaaggcgtgcatcctgtcgagggtgtacccgtcg
ctggccatcggcaagaacgcgcgcctttacgttttcaataacgggaaggcggagatcaag
gtgtcgcagctcaccgcgtgggagatgaagaagccggtcatgatgaatggagcctaa

DBGET integrated database retrieval system