KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0414100-01Help
Entry
Os04t0414100-01   CDS       T02163                                 

Gene name
Os04g0414100
Definition
Ovarian tumour, otubain domain containing protein.
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(20458615..20459313,20459582..20459743,20461090..20461167,20461643..20461721,20461816..20461961,20462071..20462139,20462269..20462437,20462533..20462783)
AA seq 550 aa AA seqDB search
MTRIFVQRGAAGSSSSSSRSGSQTLQQQQQLQATSAVAREEELPPQPHQHPSELTASDNI
TDHLVEDADNSSNSNKPLGLDDPTSESSSSAEERAVMEKPPKDDSSVIDPAFLVEELTGL
QFSDQFEQENLVQSGIGPSQIAGAASHPPPPPAPPAPPPKPSSGNNGLRRMGSGSSNNAR
IGSSRRPVAWPPVAVRSSASGSRPSSPRSLADSEGYNSADEQGPCYASNYYDSERERMFE
HDLRRVRGFEINKMAEDGNCLFRAVADQVYGDPEAYDMARQMCVDYMERERDHFSQFMTE
GFTSYCRRKRRDKVYGNNMEIQAFAEMYNRPIHIYSYSTEPINIFQGSYNTDVPPIRLSY
HHGNHYNSVVDPRGLTVGAGLGFSSLRGTNNVDRDQVKAAIKAQQDQQIENALLAEGRLY
SDLELTEKEIERMVMEASRAEYLKQQQQQLNFRESSTSGAEPSSSAAISGSSRSAGTADR
VGEECFVLPDTVLTRSMQLLLAMGFNYIQVMEAYSIFGEDVDSMIYYLVEMGGTGASAGG
SNRRKGKAAE
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggatcttcgtgcagcgcggggctgccggctcctcgtccagctccagccgctcg
gggtcacagacactgcagcagcagcagcaactgcaggcgacatcagcggttgcccgggag
gaggagctgccgccgcagcctcatcagcatccatcggagctcacggcttcagacaatata
actgaccatctagtggaggatgctgataacagcagtaatagtaataagccattggggcta
gatgatcccacatcagagagttcaagctctgcagaggagagggctgttatggagaaacct
cccaaagacgactccagtgtgatcgatcctgctttcttggtggaggaattaacaggcctc
cagttttctgatcagtttgagcaggaaaatctagtgcagtcaggtattggtccatcacag
attgctggtgcagcatcacacccaccacctccaccagctccaccagccccaccaccgaaa
ccatcgtctggtaataatgggttaaggagaatggggtctggaagctcaaacaatgcacgg
attggatcttcaagaaggccagttgcttggccaccagtggcagttcggtcatctgcttcg
ggttcccgaccttcttcacctagatcacttgctgatagtgaagggtataatagtgcagat
gagcagggcccctgttacgcctctaattattatgattcggaaagggagcgcatgtttgaa
catgacctaagacgagtgagaggatttgaaatcaataagatggctgaagatgggaattgt
ctgtttagagcagttgcagatcaagtttatggtgatccagaagcttatgacatggctagg
cagatgtgtgttgattacatggaaagggaacgtgatcatttctcgcagttcatgacggaa
ggttttacatcatattgtaggagaaaaagaagagataaggtatatgggaacaatatggag
atccaggcatttgctgagatgtacaatcgtccgattcacatatattcctatagtacagag
cccattaacatttttcaaggaagctacaatacagatgtccctccaattaggctaagttac
catcatggtaatcattacaattcggtggttgatcctcgtgggctgacagtaggggcaggc
ctgggatttagttcccttagagggacaaataacgttgacagggatcaggtgaaggctgca
ataaaagcacagcaagatcagcagattgagaatgcacttctggctgaaggacgactatac
tctgatttggagttgacagagaaggaaatagagcggatggtgatggaggcctcacgagca
gagtatctaaagcagcagcaacaacaacttaacttcagagagtcatcaacatcaggggca
gagccatcttcttctgctgcgattagtgggtcttctcggtcagctgggactgccgataga
gttggcgaggagtgcttcgttctcccggacaccgtgctaacccgcagcatgcagctcctc
ctggcaatgggcttcaactacatccaggtcatggaagcctatagcatatttggcgaggac
gtcgactcaatgatctactaccttgtggagatgggaggcaccggagcctctgcaggtggt
agcaatcgcaggaaaggaaaagctgctgagtga

DBGET integrated database retrieval system