KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0432500-01Help
Entry
Os04t0432500-01   CDS       T02163                                 

Gene name
Os04g0432500
Definition
Similar to Protein disulfide isomerase.
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Os04t0432500-01 (Os04g0432500)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Os04t0432500-01 (Os04g0432500)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Os04t0432500-01 (Os04g0432500)
  Exosomal proteins of colorectal cancer cells
   Os04t0432500-01 (Os04g0432500)
  Exosomal proteins of bladder cancer cells
   Os04t0432500-01 (Os04g0432500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:complement(join(21464741..21464980,21463982..21464085,21463519..21463889,21462982..21463289,21462454..21462702))
AA seq 423 aa AA seqDB search
MAATTTRPLPLLLLLLLPPLLLLLLSFHAAAAAAAEEFPRDGRVIELDESSFEAALGAID
YLFVDFYAPWCGHCKRLAPELDEAAPVLAGLSEPIIVAKVNADKYRKLGSKYGVDGFPTL
MLFIHGVPIEYTGSRKADLLVRNLNKFVAPDVSILESDSAIKSFVENAGTSFPMFIGFGV
NESLIAGYGGKYKKRAWFAVAKDFSEDFMVTYDFDKVPALVSLHPKYKEQSVFYGPFEGS
FLEDFIRQSLLPLTVPINTETLKMLDDDDRKVVLAILEDDSDETSSQLVKVLRSAANANR
DLVFGYVGIKQWDEFVETFDISKSSQLPKLIVWDRNEEYEVVEGSEKLEEGDQASQISQF
LEGYRAGRTTKKKVSGPSFMGFLNSLVSLNSLYILICVFALLGVMIYFTGQDDTPQVRRA
HEE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacgacgacgagacccctccccctcctcctcctgctgcttctgcctcctctc
ctcctcctgctgctctccttccacgccgccgccgccgccgccgccgaggagttcccgcgc
gacgggcgggtgatagagctggacgagagcagcttcgaggcggcgctgggcgccatcgac
tacctcttcgtcgacttctacgcgccatggtgcggccactgcaagcgcctcgcccccgag
ttagatgaagctgcaccggtgttggcaggactgagtgagcccatcatagttgccaaagta
aatgctgacaagtacaggaagcttggatcgaaatatggagtggacgggttccctacactg
atgctttttatccacggggtccccatcgaatacactggttcaagaaaagctgacttgctt
gtccgcaatcttaataagtttgttgcacctgatgtttctattcttgagtcggactctgcg
atcaagagctttgttgagaatgctggcacgagctttccaatgttcattgggtttggggtg
aatgagtcgttgattgctggttatggagggaaatacaagaaaagagcatggtttgctgtt
gcaaaagatttttctgaggacttcatggtcacttatgattttgataaggttcctgcattg
gtttcacttcatccaaagtacaaagaacaaagtgtattttatggcccatttgaaggaagt
ttcttggaagattttatacggcaatccctgcttcctttgactgtccccatcaacacagag
acactcaaaatgttggatgatgatgacagaaaagttgttcttgcaattttggaggatgat
tcagatgaaacttcttcacagttggtaaaagttttgaggtctgctgccaatgcaaaccgt
gacttggtgtttgggtatgtcggaatcaaacaatgggatgagtttgtcgagacttttgat
atttccaagagctcacagctgccaaagctaatcgtctgggatagaaatgaggagtatgaa
gtggtggaaggctcagagaagttagaggaaggtgatcaagcttctcaaataagccaattc
cttgagggatatagagcaggaagaacaacaaagaagaaagtcagtggcccatctttcatg
ggtttcctgaactctcttgtcagcctgaactcgctatacattcttatatgtgtcttcgct
cttcttggtgtcatgatatactttactgggcaagatgatactcctcaggtaagacgagct
catgaagagtga

DBGET integrated database retrieval system