KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0443300-00Help
Entry
Os04t0443300-00   CDS       T02163                                 

Gene name
Os04g0443300
Definition
Endoglucanase 11.
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dosa00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:complement(join(22084022..22084258,22083281..22083937,22082705..22082980,22081905..22082237))
AA seq 500 aa AA seqDB search
MSPSSSSSSWRALVLVAAAVLSFSGHVVVAAAAAGHPDYADALAKSILFFQGQRSGRLPP
DQAVKWRSNSGLSDGSAANVDLTGGYYDGGDNVKFGFPMAFTTTMLSWGVVEYGGRMRGR
VLRDARDAVRWAADYLLRAATATPGVLYVGVGDPDADHRCWERPEDMDTPRAVYSVSASS
PGSDVAAETAAALAAASLALRAADPGYSRRLLAAARDVMAFAVRHQGKYSDHVGGDVGAY
YASYSGYQDELLWGSAWLLWATRNASYLDYLASLGANDGVDMFSWDNKLAGARVLLSRRA
LVNGDRRLDAFRRLAEDFICRILPGSPSSTTQYTPGGMMYKSGHANLQYVTSASFLLTTF
AKYMAVSNHTFSCQSLPVTAKTLRALARKQVDYILGANPQGMSYMVGYGARFPQRIHHRG
ASMPSVAAYPAHIGCQEGFSGYFNAGGANPNVHTGAVVGGPDQHDAFPDERGDYDRSEPT
TYTNAALVGCLAYFAGSYRS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtcgtcgtcatcatcatcatggcgggctctcgtgcttgtcgccgccgccgtc
ttgtcattctccggccatgtcgtcgtcgccgccgccgccgccggacaccctgattacgcc
gacgcgctcgccaagtcgattctcttcttccaagggcagaggtccggccgccttccgccg
gaccaggccgtcaagtggaggtccaactccggcctctccgacggttcggcggcgaacgtt
gacctcaccggcggctactacgacggcggcgacaacgtcaagttcgggttcccgatggcg
ttcacgacgacgatgctgtcgtggggcgtcgtggagtacggcgggcggatgcgggggcgc
gtactccgcgacgcgcgcgacgcggtgcggtgggcggcggactacctcctcagggcggcg
acggcgaccccgggtgtgctctacgtcggcgtcggcgaccccgacgccgaccaccggtgc
tgggagcggccggaggacatggacacgccgcgggccgtgtactcggtgtcggcgtcgagc
cccgggtcggacgtggccgccgagaccgcggcggcgctcgccgccgcgtcgctggcgctc
agggccgccgacccggggtactcccggaggctgctcgcggcggcgagggacgtcatggcg
ttcgccgtgcggcaccaggggaagtacagcgaccacgttggcggcgacgtgggcgcctac
tacgcctcctactccggctaccaggacgagctcctgtgggggtccgcgtggcttctctgg
gcgacgaggaacgcctcctacctcgactacctcgcctccctcggcgccaacgacggcgtc
gacatgttcagctgggacaacaagctcgccggagcgcgcgtcctcctgtcgcggagggcg
ctggtgaatggcgatcggaggctggacgcgttccggcggctggcggaggacttcatctgt
aggatcctgccggggtcgccgtcgtcgacgacgcagtacacgcccggcgggatgatgtac
aagtccggtcacgccaacctgcagtacgtcacctcggccagcttcctcctcaccacgttc
gccaagtacatggccgtctccaaccacaccttctcctgccagagcctccctgtcaccgcc
aagaccctccgagctctcgccaggaaacaggtggactacatcctgggcgcgaacccgcag
gggatgtcgtacatggtgggctacggcgcgcggttcccgcagaggatacaccacaggggg
gcgtcgatgccgtcggtggcggcgtacccggcgcacatcggctgccaggaagggttcagc
ggctacttcaacgccggcggcgccaaccccaacgtccacaccggcgccgtcgtcggcggg
ccggaccagcacgacgcgttccctgacgagcgcggcgactacgaccggtcggagccgacg
acgtacaccaacgccgccctcgtcggctgcctcgcctacttcgccggcagctacaggagc
tga

DBGET integrated database retrieval system