KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0452400-01Help
Entry
Os04t0452400-01   CDS       T02163                                 

Gene name
Os04g0452400
Definition
Similar to Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15) (Ubiquitin- specific processing protease 4) (AtUBP4).
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Os04t0452400-01 (Os04g0452400)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os04t0452400-01 (Os04g0452400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr04:complement(join(22573090..22573212,22571549..22571665,22569310..22569408,22568803..22568988,22568532..22568713,22567836..22568232))
AA seq 367 aa AA seqDB search
MVMGASGSKLEKALGDQFPEGERYFGLENFGNTCYCNSVLQALYFCIPFREKLLEYYANN
KTPGDAEENLLTCLADLFMQVSQSKKKTGVIAPKRFVQRVKKQNELFRSYMHQDAHEFLN
FLLNELVDILEKESNAAKDSPQSSSPEKVPNGPVQPLANGVRKEPPVTLVHKNFQGILTN
ETRCLRCETVTARDETFFDLSVDIEQNSSITSCLKNFCSTETLNAEDKFFCDKCCSLQEA
QKRMKIKKAPHILVIHLKRFKYIEQLGRYKKLSYRVVFPMELKLSTSDDVDTEYSLFAVV
VHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMVEESTLQTFFGSSHEYSGNTDHGYILFY
EGLGGKS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgggagccagcggctccaagctcgagaaggccctcggcgaccagttcccggaa
ggcgagcgctacttcggcctcgagaacttcggcaacacctgctactgcaacagtgtcctc
caggcactatatttctgcatcccgttcagggagaaattgctggaatattatgcaaataac
aaaactcctggagatgcggaggagaaccttttgacttgtttggcggatcttttcatgcag
gtaagccagtcaaagaaaaagactggcgttattgctccaaaacgctttgtccaaagagta
aagaaacagaatgaactatttcgcagctacatgcaccaggatgcacatgagttcttaaat
tttctgttgaatgagcttgttgatattctggaaaaggagtctaatgctgcgaaggactcc
cctcaatcatcatctcctgaaaaggttccaaacgggccagttcaacctttagccaatggt
gttagaaaagaaccaccggttaccttggtgcataagaattttcagggcatactgaccaat
gagaccagatgcttaagatgcgagacagtaacagcaagggatgaaacattttttgatctg
agtgttgatattgagcagaatagttctatcacaagctgcttgaaaaacttctgctccacg
gagactttaaatgctgaggacaaattcttctgtgacaaatgctgcagcttgcaagaagca
cagaagagaatgaagatcaagaaggctccacacatattagttatccacctaaagcgcttc
aagtacatagagcagcttggtcggtataagaagctttcataccgggttgtattcccaatg
gagctgaagctcagtacatctgatgatgtagataccgagtactccctctttgctgtcgtt
gtccatgttggaagtggccccaaccatggacattatgtaagccttgtcaaaagccacaac
cactggttgttcttcgatgatgaaaatgtcgagatggttgaggagtcgaccctgcaaaca
ttcttcggttcttcacatgaatactcaggcaacacggaccatggatacatcttgttttat
gagggtcttggtgggaagagttag

DBGET integrated database retrieval system