KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0458300-01Help
Entry
Os04t0458300-01   CDS       T02163                                 

Gene name
Os04g0458300
Definition
Similar to OSIGBa0097P08.2 protein.
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os04t0458300-01 (Os04g0458300)
   00052 Galactose metabolism
    Os04t0458300-01 (Os04g0458300)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Os04t0458300-01 (Os04g0458300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(22893902..22894097,22894211..22894260,22895357..22895480,22895574..22895681,22897848..22898512)
AA seq 380 aa AA seqDB search
MARPAPLLLLLAAVCLVAAASAGGADAAERKATTVGVYELRKGDFSIRVTNWGAVIMSVV
LPDSRGKLDDVVLGYDTIAEYVNSSTYFGALVGRVANRIAKARFVLDGKAYHLYPNDGKN
TLHGGHRGFSNVTWTVKEHVGGGDAPYITLYYHSFDGEQGFPGALDVYVTYQLSGPYVLS
VHMNATAAGKATPVNLAQHSYWNLGGTGSGDILGNTVQLFASRYTPVDAELIPTGQVAPV
TGTPYDLRAPTPVGARVHLVTGGLSKTGATIYGFDTNYAVDGGDDVDAHAHALRRVTVVR
DGKSGRSLELWANQPGVQFYTGNFLTADVKGKGGKAYGQYGALCLETQGFPDAVNHPNFP
SVIVRPGQVYKHEMVYKFSF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctagaccagctccgctgctgcttcttctcgcggcggtgtgcctagtggccgccgcc
tccgccggcggtgccgatgcggcggagaggaaggcgacgacggtcggcgtctatgagctc
aggaagggagatttctccatcagggtcaccaattggggagcggtcatcatgtccgtcgtg
cttcctgactccagagggaaattggacgatgttgttcttggatatgacaccattgctgaa
tatgttaattcttctacttactttggagcgctcgtcggacgggtagccaacagaattgcc
aaggcgcggttcgtgctcgatggaaaagcttatcatctgtatccaaatgatggcaaaaac
acacttcacggtggtcacaggggtttcagcaatgttacatggacagtgaaggagcatgtt
ggtggaggtgacgcaccatacatcacactgtactaccatagctttgacggagaacaagga
ttcccaggcgccctagacgtgtacgtgacgtaccagctgtccggcccgtacgtgctgagc
gtgcacatgaacgcgacggcggcgggcaaggcgacgccggtgaacctggcgcagcactcg
tactggaacctcggtggcacgggcagcggcgacatcctgggtaacacggtgcagctgttc
gcgtcgcggtacacccccgtggacgccgagctcatcccgacgggccaggtcgcgcccgtc
accggcacgccctacgacctccgcgcgccgacgcccgtgggcgcgcgcgtccacctggtg
acgggcggcctcagcaagacgggcgccaccatctacggcttcgacaccaactacgccgtg
gacggcggtgacgacgtcgacgcgcacgcgcacgcgctgcggcgggtgaccgtcgtccgg
gacggcaagtccgggcggtcgctggagctgtgggcgaaccagcccggggtgcagttctac
accggcaacttcctcacggccgacgtgaaggggaagggcgggaaggcgtacgggcagtac
ggcgcgctgtgcctggagacgcaggggttccccgacgccgtgaaccaccccaacttcccg
tcggtgatcgtgaggcccggacaggtgtacaagcacgagatggtgtacaagttctcgttc
tag

DBGET integrated database retrieval system