KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0458600-01Help
Entry
Os04t0458600-01   CDS       T02163                                 

Gene name
Os04g0458600
Definition
Similar to ORW1943Ba0077G13.3 protein.
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os04t0458600-01 (Os04g0458600)
   00052 Galactose metabolism
    Os04t0458600-01 (Os04g0458600)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Os04t0458600-01 (Os04g0458600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(22902640..22902826,22902922..22902968,22904401..22904524,22904610..22904717,22904806..22905428)
AA seq 362 aa AA seqDB search
MAGARLSLAFLCFVVVVVASALAGGAGARKTVGEYVLRKGDFSVKITNWGATMMSVVLPD
SKGNLADVVLGLDTIAEYNDTNYFGPVTGRVGQRIARGRFVLDGKVYHTYINDGRNAIHG
GHRGFSKVIWTVKEYVGGGDSPYITLYYRSFDGEQGFPGDLDAYVTYQLSSPYVLALRMN
ATALNKATPVNFLQHTYWNLGGQGRGDVLGHTLQLSASRYTPLDEELLPSSGVVAPVAGT
PYDFRHPTPIGARIRQVMGGRIAGYDINYVIDGEGMRKVAAARDGASGRALELWANQPAM
QLYTGNWLNNIKGKGGKVYQQYGGFCLETQGYVDAVNHPEFPSMTVRPGQVYRHDMAFKF
SF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggctggagctcggttgtctctcgcgttcctgtgctttgtggtggtggtggtggcctcc
gcgctcgccggcggcgccggtgcgaggaagacggtcggcgagtacgtgctcaggaagggg
gacttctccgtgaagatcaccaactggggagcaaccatgatgtcggtcgtcctccctgat
tccaaagggaatttggctgatgttgtgcttggcctagacaccattgctgagtacaacgac
actaattacttcgggccggttaccggacgggtcgggcagaggatagccagggggcggttc
gttctcgacgggaaggtgtatcacacgtacatcaacgacggcaggaacgcgattcacggt
ggacacagagggttcagcaaagtcatatggacggtgaaggagtacgtcggcggcggcgac
tcgccgtacatcaccttgtactaccgcagcttcgacggagagcaaggtttccccggggac
ctggacgcgtacgtgacgtaccagctgtcgagcccgtacgtgctggcgctgcgcatgaac
gcgacggcgctgaacaaggcgacgccggtgaacttcctgcagcacacgtactggaacctc
ggcgggcagggccgcggcgacgtgctggggcacacgctgcagctgtcggcatcccggtac
accccgctggacgaggagctcctcccgtcgtcgggcgtcgtcgcgcccgtcgccggcacg
ccctacgacttccggcaccccaccccgatcggcgcgcgcatccggcaggtgatgggcggg
cgcatcgccgggtacgacatcaactacgtgatcgacggcgagggcatgcggaaggtggcc
gcggcgcgggacggcgcgtcgggccgcgcgctggagctgtgggcgaaccagccggccatg
cagctgtacaccggcaactggctgaacaacatcaagggcaagggcggcaaggtgtaccag
cagtacggcgggttctgcctggagacgcaggggtacgtggacgccgtgaaccacccggag
ttcccctccatgacggtcaggcccggccaggtgtacaggcacgacatggccttcaagttc
tccttctag

DBGET integrated database retrieval system