KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0467700-01Help
Entry
Os04t0467700-01   CDS       T02163                                 

Gene name
Os04g0467700
Definition
Similar to Indole-3-glycerol phosphate synthase, chloroplast precursor (EC 4.1.1.48) (IGPS).
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Os04t0467700-01 (Os04g0467700)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Os04t0467700-01 (Os04g0467700)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Os04t0467700-01 (Os04g0467700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr04:complement(join(23364805..23364933,23364040..23364114,23363900..23363944,23363626..23363790,23363364..23363442,23362841..23362923,23362669..23362737,23362471..23362566))
AA seq 246 aa AA seqDB search
APPVRDFVGVLKASFDRTGLPALIAEVKKASPSRGVLREDFEPVQIAQTYEKNGAACLSV
LTDAKYFQGSFDYLDAIRNAGVQCPLLCKEFIVDAWQLYYARLKGADAVLLIAAVLPDLD
IKYMLKICKILGMAALVEVHDEREMDRVLGIDGVQLIGINNRNLETFQVDISNTKNLLEG
ERGQTIAQKGIIVVGESGLFTPDHISFVQNAGVKAVLVGESLIKQEDPGKAIAGLFGKDI
SPVSAA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gctcctccggtgagggatttcgttggggtgttgaaggcgtcttttgatcggactggtctg
cctgctctgattgcagaggtcaagaaggcttcaccgagccgcggtgtcctgagggaggac
ttcgagccggttcagatcgcccaaacatatgagaaaaatggagcagcatgcttaagtgtt
ctcacagatgcaaaatactttcagggaagttttgactatttggatgctatacgcaatgct
ggagtacagtgtcctctgctgtgcaaagagttcattgttgatgcctggcaactttactat
gcgcgtttgaagggagcagatgctgttcttctgattgctgctgtcttacctgatcttgat
atcaagtatatgttgaaaatatgcaaaatacttggcatggctgctttagttgaggtgcat
gatgaaagggaaatggaccgtgtgttagggatagatggtgtccagctcatcggcatcaat
aaccgtaacctcgagacttttcaagttgatatttcaaacactaaaaatcttcttgagggt
gaaagaggacaaactatagctcagaaaggcataattgttgtaggggaatcagggctgttc
acaccagaccatatttcattcgttcagaatgctggggttaaagctgttctcgttggggag
tctctcatcaagcaggaggatcctggcaaagcaatcgctgggcttttcggcaaagacatc
tcacctgtgagtgctgcgtaa

DBGET integrated database retrieval system