KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0469500-01Help
Entry
Os04t0469500-01   CDS       T02163                                 

Gene name
Os04g0469500
Definition
Similar to OSIGBa0124N08.2 protein.
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dosa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dosa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dosa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dosa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dosa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dosa00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(23463435..23464070,23464662..23465489)
AA seq 487 aa AA seqDB search
TPLPLSLADTWTPPLPTPATPTAARPPTPPPRPTPPSPSRRSPSATCPCSRRRRRRPTRS
PTRSPATPTSTRRPPSTSPRVTSPSATPSSTSPPRRRPRSSPTARAGPRAGVAVDPARAR
AAVVTCGGLCPGLNTVLRELVVGLRELYGVRDVFGVAAGYRGFYGPDADHARLDLAAVDD
WHKKGGTVLKTTRGGFDLNKIVDGIVARGYTQVYAIGGDGTMRGAVAIFNEFKRRGLNIS
ITGIPKTVDNDIGIIDRSFGFQTAVEIAQQAIDAAHVEAVSAVNGIGLVKLMGRSTGHIA
LHATLSSRDVDCCLIPEVDFYLEGKGGLFEFLYERIKQKGHAVVVVAEGAGQELIPRTDD
QKREQDESGNIVFLDVGPWLKSELGKWWKREHPSELFTVKYIDPTYMIRAVPANATDNLY
CTLLAHSAIHGIMAGYTGFVPGPINGNYSYIPLEDVAVAKNPVDVNDHKWAWVRSVTNQP
DFMKPKY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
acccctctccctctctctctggccgacacatggaccccaccgctcccaactccggcgacg
ccaacggcggcgcggccgccgacgccaccgccccgtccaacaccaccgtcaccctcccgc
cgctcaccctccgcgacgtgcccctgctcccgtcggcggcggcggcgaccgacacgatcc
ccaacccgatctcccgccacccctacttccacccgccggccaccttctacatctccccgg
gtgacgtctccctccgccacgccttcttcgacctcgcctccgcgtcgccgtccccgctcg
tcgcctaccgcccgcgcggggccgcgcgcgggggtcgccgtggaccccgcccgcgcgcgc
gccgcggtcgtcacctgcggggggctctgcccgggcctcaacaccgtcctcagggagctc
gtcgtcggcctccgggagctctacggcgtccgcgacgtcttcggcgtcgccgccggctac
cgcgggttctacggccccgacgccgaccacgcccgcctggacctggccgccgtcgacgac
tggcacaagaagggcggcaccgtgctcaagaccacccgtggtggctttgatctcaacaag
atcgttgacggcatcgtcgcgcgcgggtatacgcaggtttatgcaattggaggggatgga
acaatgagaggagctgtggccatcttcaacgagtttaagcgccgtggtttgaacatttct
attacagggatcccgaaaactgtggacaatgatatcggcatcatagacaggtcatttggg
ttccaaaccgcagtggagattgctcagcaggcaatcgacgcagcacatgtcgaggctgtg
agcgccgtgaatggcattggacttgtcaaacttatgggcaggagcacaggccacattgct
cttcatgccaccctgagcagccgcgatgttgactgctgtttgattcctgaggttgatttc
tatcttgaaggaaaggggggcctgtttgagttcttgtatgaaaggataaaacagaaggga
catgctgttgtcgttgttgctgaaggtgctggtcaggaattgattccaaggactgacgat
caaaagcgggagcaggacgagtccggcaacattgtgttccttgatgtgggtccctggtta
aaatctgagctgggtaaatggtggaagagagaacacccaagcgagttgttcactgtgaag
tatatcgatcccacttacatgatacgagctgttccagcaaatgccactgacaatctgtac
tgtacattgttggcacattcggcgatccatgggatcatggctgggtacactggcttcgtc
cctggcccgattaatggaaactatagctacataccgctggaagatgttgctgtggcgaag
aacccggtggatgtgaatgatcacaaatgggcatgggttagatcagtcacaaaccaacca
gatttcatgaagccaaaatactaa

DBGET integrated database retrieval system