KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0469500-01Help
Entry
Os04t0469500-01   CDS       T02163                                 

Gene name
Os04g0469500
Definition
Similar to OSIGBa0124N08.2 protein.
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os04t0469500-01 (Os04g0469500)
   01230 Biosynthesis of amino acids
    Os04t0469500-01 (Os04g0469500)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os04t0469500-01 (Os04g0469500)
   00030 Pentose phosphate pathway
    Os04t0469500-01 (Os04g0469500)
   00051 Fructose and mannose metabolism
    Os04t0469500-01 (Os04g0469500)
   00052 Galactose metabolism
    Os04t0469500-01 (Os04g0469500)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Os04t0469500-01 (Os04g0469500)
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Os04t0469500-01 (Os04g0469500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(23463435..23464070,23464662..23465489)
AA seq 487 aa AA seqDB search
TPLPLSLADTWTPPLPTPATPTAARPPTPPPRPTPPSPSRRSPSATCPCSRRRRRRPTRS
PTRSPATPTSTRRPPSTSPRVTSPSATPSSTSPPRRRPRSSPTARAGPRAGVAVDPARAR
AAVVTCGGLCPGLNTVLRELVVGLRELYGVRDVFGVAAGYRGFYGPDADHARLDLAAVDD
WHKKGGTVLKTTRGGFDLNKIVDGIVARGYTQVYAIGGDGTMRGAVAIFNEFKRRGLNIS
ITGIPKTVDNDIGIIDRSFGFQTAVEIAQQAIDAAHVEAVSAVNGIGLVKLMGRSTGHIA
LHATLSSRDVDCCLIPEVDFYLEGKGGLFEFLYERIKQKGHAVVVVAEGAGQELIPRTDD
QKREQDESGNIVFLDVGPWLKSELGKWWKREHPSELFTVKYIDPTYMIRAVPANATDNLY
CTLLAHSAIHGIMAGYTGFVPGPINGNYSYIPLEDVAVAKNPVDVNDHKWAWVRSVTNQP
DFMKPKY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
acccctctccctctctctctggccgacacatggaccccaccgctcccaactccggcgacg
ccaacggcggcgcggccgccgacgccaccgccccgtccaacaccaccgtcaccctcccgc
cgctcaccctccgcgacgtgcccctgctcccgtcggcggcggcggcgaccgacacgatcc
ccaacccgatctcccgccacccctacttccacccgccggccaccttctacatctccccgg
gtgacgtctccctccgccacgccttcttcgacctcgcctccgcgtcgccgtccccgctcg
tcgcctaccgcccgcgcggggccgcgcgcgggggtcgccgtggaccccgcccgcgcgcgc
gccgcggtcgtcacctgcggggggctctgcccgggcctcaacaccgtcctcagggagctc
gtcgtcggcctccgggagctctacggcgtccgcgacgtcttcggcgtcgccgccggctac
cgcgggttctacggccccgacgccgaccacgcccgcctggacctggccgccgtcgacgac
tggcacaagaagggcggcaccgtgctcaagaccacccgtggtggctttgatctcaacaag
atcgttgacggcatcgtcgcgcgcgggtatacgcaggtttatgcaattggaggggatgga
acaatgagaggagctgtggccatcttcaacgagtttaagcgccgtggtttgaacatttct
attacagggatcccgaaaactgtggacaatgatatcggcatcatagacaggtcatttggg
ttccaaaccgcagtggagattgctcagcaggcaatcgacgcagcacatgtcgaggctgtg
agcgccgtgaatggcattggacttgtcaaacttatgggcaggagcacaggccacattgct
cttcatgccaccctgagcagccgcgatgttgactgctgtttgattcctgaggttgatttc
tatcttgaaggaaaggggggcctgtttgagttcttgtatgaaaggataaaacagaaggga
catgctgttgtcgttgttgctgaaggtgctggtcaggaattgattccaaggactgacgat
caaaagcgggagcaggacgagtccggcaacattgtgttccttgatgtgggtccctggtta
aaatctgagctgggtaaatggtggaagagagaacacccaagcgagttgttcactgtgaag
tatatcgatcccacttacatgatacgagctgttccagcaaatgccactgacaatctgtac
tgtacattgttggcacattcggcgatccatgggatcatggctgggtacactggcttcgtc
cctggcccgattaatggaaactatagctacataccgctggaagatgttgctgtggcgaag
aacccggtggatgtgaatgatcacaaatgggcatgggttagatcagtcacaaaccaacca
gatttcatgaagccaaaatactaa

DBGET integrated database retrieval system