KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0481400-01Help
Entry
Os04t0481400-01   CDS       T02163                                 

Gene name
Os04g0481400
Definition
Similar to Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (Protein- beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase).
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Os04t0481400-01 (Os04g0481400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:complement(join(24076242..24076548,24075858..24076039))
AA seq 162 aa AA seqDB search
MLSSDHCLLAIQQFWTQGSLDKNKALVEYLKQYGAVRTDKVAEVMESIDRALFVAEGLTP
YTDSPMPIGYNATISAPHMHATCLELLKDHLQPGMHALDVGSGSGYLTACFAMMVGPEGR
AVGIEHIPELVAASTENVQRSAAAQLLKDGSLSFHVAGMLSC
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgctttcatctgaccattgcttgcttgccatccagcaattctggactcaaggatcactg
gacaagaacaaagctcttgtcgaatacctgaagcaatatggtgctgttagaactgataaa
gtggctgaagtaatggaaagcattgacagagcattgttcgtagcagagggccttactcct
tacactgacagccctatgcctattggttataacgcgacgatatctgctcctcacatgcat
gcgacctgcttggagctactgaaggatcacttgcagccaggaatgcatgctctagatgtt
ggatcaggcagcggttacttgacagcttgttttgcaatgatggttggaccagaaggccgt
gcagtggggatagaacatattcctgagcttgtcgctgcttcgactgagaatgtccaaaga
agtgccgcagcacaattactgaaggatggatctctttctttccatgttgcaggtatgcta
agctgctaa

DBGET integrated database retrieval system