KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0484900-01Help
Entry
Os04t0484900-01   CDS       T02163                                 

Gene name
Os04g0484900
Definition
Similar to Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis.
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Os04t0484900-01 (Os04g0484900)
Transfer RNA biogenesis [BR:dosa03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Os04t0484900-01 (Os04g0484900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:complement(join(24240164..24240663,24239677..24239746,24239390..24239562,24239086..24239260,24238796..24238962,24238457..24238676,24238260..24238364,24237829..24237981,24237289..24237447))
AA seq 573 aa AA seqDB search
MATAVAAAGGGGGGEQPRRRKPAPGRGGVVLPAGLSEEEARVRAIAEIVSAMGELSRRGE
DVDLNALKSAACRRYGLARAPKLVEMIAAVPEADRAALLPRLRAKPVRTASGIAVVAVMS
KPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQ
LKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVCYSEHGAVK
CIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLA
KDAGFKVVAHMMPDLPNVGVERDLESFREFFENPAFRADGLKIYPTLVIRGTGLYELWKT
GRYRNYPPELLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMEDL
GLKCRDVRTREAGIQDIHHKIRPDEVELVRRDYAANEGWETFLSYEDTQQDILIGLLRLR
KCGRNVTCPELVGRCSIVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARKEHR
SKKIAVISGVGTRHYYRKLGYELEGPYMVKCLV
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgtagccgccgccggcggtggcggcggcggcgagcagccgcgcaggagg
aagccggcgccggggagagggggagtggtgctccccgcggggctgtcggaggaggaggcg
cgggtgcgggccatcgcggagatcgtgtcggcgatgggggagctctcgcggcgaggggag
gacgtggacctgaacgcgctcaagtcggccgcgtgccggaggtacgggctggcgcgggcg
ccgaagctggtggagatgatcgcggcggtgccggaggccgaccgcgccgcgctgctccca
aggctgcgcgccaagcccgtgcgcacggcgtcgggcattgccgtggtcgccgtgatgtcg
aagccgcaccggtgcccccacatcgccaccacggggaacatctgcgtgtactgccccgga
ggccccgactccgacttcgagtacagcacccagtcctacaccggctacgagcccaccagc
atgcgcgccattcgagcaaggtacaatccatatgtgcaggccagaagcaggatagatcag
ctcaaaaggctaggccatagtgtagacaaggtcgaattcatattgatgggtggaactttc
atgtcattaccagctgattatcgggattatttcattagaaatcttcatgatgccttatcg
ggacacacttctgctaatgttgaagaggctgtttgttattcagaacatggtgcagtcaaa
tgtattggcatgacaattgagacgagacctgattattgcttggggcctcatttgcgccag
atgctatcttatggttgtacccgcttagaaattggtgttcagagcacatacgaggatgtt
gcacgtgacacaaacagaggtcacactgtagctgctgttgctgattgcttttgtttggct
aaagatgctggttttaaggtggtcgcccacatgatgccagatttacctaatgttggagtt
gaaagagatctggaaagtttccgagaattttttgaaaatccagcattccgagctgatggt
ctaaagatttatccaactcttgtgattcgtggaactggcctttatgagctctggaaaact
ggcagataccgaaactatccacctgaacttctggtggatattgttgcaagaattctatcc
atggtaccaccttggacacgagtttaccgtgtacaaagagatatccctatgcctcttgtt
acttctggtgttgaaaaaggtaatcttcgtgagcttgctttggctcgaatggaagattta
ggcttgaagtgccgagatgttagaactcgtgaggcgggaattcaggatatccatcacaaa
attagacctgacgaagtagagcttgttaggcgtgactatgctgcaaatgagggctgggag
acctttctctcatacgaggatacacagcaggatatccttattggtctgctgcgattgcga
aaatgtggccgcaatgttacatgccctgagctagtagggaggtgttcaattgtccgtgaa
cttcatgtatatggaactgcagtccctgtacatggtcgtgatgcagacaaactacaacac
cagggttatggtactcttttgatggaagaagcagaaagaattgctcgcaaggagcatcgt
tcaaagaaaatcgctgttatatcaggagttgggactcgccactactaccgtaaactgggt
tatgaacttgaggggccttacatggtcaaatgtctggtctaa

DBGET integrated database retrieval system