KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0486950-01Help
Entry
Os04t0486950-01   CDS       T02163                                 

Gene name
Os04g0486950
Definition
Similar to Malate synthase.
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os04t0486950-01 (Os04g0486950)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Os04t0486950-01 (Os04g0486950)
   00630 Glyoxylate and dicarboxylate metabolism
    Os04t0486950-01 (Os04g0486950)
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Os04t0486950-01 (Os04g0486950)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:complement(join(24327802..24328176,24327392..24327717,24326798..24327128,24326037..24326708))
AA seq 567 aa AA seqDB search
MATNAAAPPCPCYDTPEGVDILGRYDPEFAAILTRDSLAFVAGLQREFRGAVRYAMERRR
EAQRRYDAGELPRFDPATRPVREAGGWACAPVPPAIADRTVEITGPAEPRKMVINALNSG
AKVFMADFEDALSPTWENLMRGQVNLRDAVAGTITYRDAARGREYRLGDRPATLFVRPRG
WHLPEAHVLVDGEPAIGCLVDFGLYFFHSHAAFRSGQGADFGPFFYLPKMEHSREARIWK
GVFERAEKEAGIGRGSIRATVLVETLPAVFQMEEILHELRDHSAGLNCGRWDYIFSYVKT
FRARPDRLLPDRALVGMAQHFMRSYSHLLIQTCHRRGVHAMGGMAAQIPIKDDAAANEAA
LELVRKDKLREVRAGHDGTWAAHPGLIPAIREVFEGHLGGRPNQIDAAAGDAARAGVAVT
EEDLLQPPRGARTVEGLRHNTRVGVQYVAAWLSGSGSVPLYNLMEDAATAEISRVQNWQW
LRHGAVLDAGGVEVRATPELLARVVEVEMARVEAEVGAERFRRGRYAEAGRIFSRQCTAP
ELDDFLTLDAYNLIVVHHPGASSPCKL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaacgccgcagcgccgccgtgcccgtgctacgacacgccggagggcgtggac
atcctcggccggtacgacccggagttcgcggccatcctcacccgcgactcgctggccttc
gtggccggcctgcagcgcgagttccgcggcgccgtccggtacgccatggagcgcaggcgg
gaggcgcagcggcggtacgacgccggcgagctcccccggttcgacccggccacgaggccc
gtccgcgaggcaggcggctgggcgtgcgcccccgtgccgccggccatcgccgaccgcacc
gtcgagatcaccggccccgccgagccgcgcaagatggtcatcaacgccctcaactccggc
gccaaggtcttcatggctgacttcgaggacgcgctgtcgccgacgtgggagaacctgatg
cgcgggcaggtgaacctgcgcgacgcggttgccggcacgatcacctaccgcgacgcggcg
cgagggcgggagtacaggctcggcgaccgccccgcgacgctcttcgtgaggccgcgcggc
tggcacctccccgaggcgcacgtcctcgtcgacggcgagccggccatcggctgcctcgtc
gacttcggcctctacttcttccacagccacgccgccttccgctccggccagggcgccgac
ttcggccccttcttctacctccccaagatggagcactctagggaggcgaggatatggaag
ggggtgttcgagagggcggagaaggaggcggggatagggagggggagcatcagggcgacg
gtgctggtggagacgctgccggcggtgttccagatggaggagatcctgcacgagctgcgc
gaccactcggcggggctcaactgcggccgctgggactacatcttcagctacgtcaagacg
ttccgcgcccgccccgaccgcctcctccccgaccgcgccctcgtcggcatggcccagcac
ttcatgcgctcctactcccacctcctcatccagacctgccaccgccgcggcgtccacgcc
atgggcggcatggcggcgcagatcccgatcaaggacgacgcggcggcgaacgaggcggcg
ctggagctggtgcgcaaggacaagctgcgggaggtgcgcgccgggcacgacgggacgtgg
gcggcgcacccggggctcatcccggcgatccgggaggtgttcgagggacacctcggaggg
aggccgaaccagatcgacgcggcggctggcgacgccgcccgtgccggcgtcgccgtcacg
gaggaggacctgctccagccgccgcgcggggcgcgcacggtggagggcctgcgccacaac
acgcgcgtcggcgtgcagtacgtcgcggcgtggctatccgggtcgggctccgtgccgctg
tacaacctgatggaggacgccgccaccgcggagatcagccgggtgcagaactggcagtgg
ctccggcacggcgcggtgctggacgccggcggcgtggaggtccgggccacgcccgagctg
ctggcgcgcgtcgtggaggtggagatggcgagggtggaggccgaggtgggcgccgagagg
ttccggcgcggccggtacgcggaggccggcaggatcttcagccggcagtgcaccgcgccg
gagctggacgacttcctcacgctcgacgcgtacaacctcatcgtggtgcaccaccccgga
gcatcgtcgccgtgcaagctctga

DBGET integrated database retrieval system