KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0490100-00Help
Entry
Os04t0490100-00   CDS       T02163                                 

Gene name
Os04g0490100
Definition
Similar to protoporphyrinogen IX oxidase (mitochondrial)2.
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Os04t0490100-00 (Os04g0490100)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Os04t0490100-00 (Os04g0490100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(24483127..24483213,24483507..24483547,24484813..24484945,24485620..24485808,24485908..24485982,24486991..24487117,24487726..24487834,24487918..24487992,24488148..24488258,24488511..24488517)
AA seq 317 aa AA seqDB search
EFITLLQVVDYLIDPFVAGTSGGDPESLSIRHAFPALWNLENKYGSVIAGAILSKLSTKG
DSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVGDGNVKLGTEVLSLACCCDGVSS
SGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQRMKFTKGGVPFVLDFLPKVDYLP
LSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLGTLFSSMMFPDRAPNDQYLYTSF
IGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFVKHVHWRNAFPLYGQNYDLVLEA
IAKMENNLPGFFYAGKK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gaatttataactttattacaggttgttgattatcttattgatccatttgtggctggaaca
agcggaggagatcctgagtcattatcaattcgtcatgcatttccagcattatggaatttg
gagaataagtatggctctgtcattgctggtgccatcttgtccaaactatccactaagggt
gattcagtgaagacaggaggtgcttcgccagggaaaggaaggaataaacgtgtgtcattt
tcatttcatggtggaatgcagtcactaatagatgcacttcacaatgaagttggagatggt
aacgtgaagcttggtacagaagtgttgtcattggcatgttgctgtgatggagtctcttct
tctggtggttggtcaatttctgttgattcaaaagatgctaaagggaaagatctcagaaag
aaccaatctttcgatgctgttataatgactgctccattgtctaatgtccagaggatgaag
tttacaaaaggtggagttccctttgtgctagactttcttcctaaggtcgattatctacca
ctatctctcatggtaacagcttttaagaaggaagatgtcaaaaaaccattggaaggattt
ggtgccttgataccctataaggaacagcaaaagcatggtctcaaaacccttgggaccctc
ttctcctcgatgatgtttccagatcgagctcctaatgatcaatatctatatacatctttc
attggggggagccataatagagacctcgctggggctccaacggctattctgaaacaactt
gtgacctctgacctaagaaagctcttgggtgttgagggacaacctacttttgtgaagcat
gtacattggagaaatgcttttcctttatatggccagaattatgatctggtactggaagct
atagcaaaaatggagaacaatcttccagggttcttttacgcaggcaagaaataa

DBGET integrated database retrieval system