KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0556300-01Help
Entry
Os04t0556300-01   CDS       T02163                                 

Gene name
Os04g0556300
Definition
Glutathione peroxidase.
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dosa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dosa00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(27838819..27838866,27839108..27839184,27839698..27839759,27839978..27840096,27840233..27840400,27840488..27840520)
AA seq 168 aa AA seqDB search
MAAAPSATSVHDFTVKDASGKDVNLSTYKGKVLLIVNVASQCGLTNSNYTELSQLYEKYK
VQGFEILAFPCNQFGGQEPGSNEEIVQFACTRFKAEYPIFDKVDVNGNNAAPLYKYLKSN
KGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcgccgtccgccacctccgtccacgacttcaccgtcaaggatgcaagcgga
aaagacgtgaacctgagcacctacaaggggaaggttctcctcatcgttaacgtcgcatcc
caatgtggcttaactaactccaactacactgagctgagccagctgtatgagaagtacaag
gtccaaggctttgagatattggctttcccgtgcaatcagtttggagggcaggaacccggc
tccaatgaggagattgtccagtttgcttgcactcgcttcaaggctgagtatcccattttt
gacaaggttgatgtcaacggtaacaatgctgcacccctgtacaagtatctgaagtctaac
aaaggtgggcttttcggtgatagcatcaagtggaacttctccaaattcttggttgacaag
gagggtcgcgtggtggatcgctatgcgcccaccacctcccctcttagtattgagaaggat
atcaagaagctgcttgggagctcttaa

DBGET integrated database retrieval system