KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0576800-01Help
Entry
Os04t0576800-01   CDS       T02163                                 

Gene name
Os04g0576800
Definition
(RAP-DB) Similar to predicted protein.
  KO
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Os04t0576800-01 (Os04g0576800)
    1.3.1.94  polyprenol reductase
     Os04t0576800-01 (Os04g0576800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Position
chr04:join(29073368..29073816,29074293..29074527,29074958..29075053,29075713..29075784,29075917..29076021)
AA seq 318 aa AA seqDB search
SIAHENTHQICSSSHIQLLYNADNLRSIFSNLQKFTVPQKYFMHFYVVGVLATTILLLAI
WFYAYMKMTPLLPESSSYSTIASHLVGSNSFSFGRVHSRTMGHKYHVWRTVFVLLLMEIQ
VLRRLYETEHVFHYSPSARMHIVGYLTGLFYYVAAPLSLASSCIPEAAEYLQGQVAEFIV
KGRARMPDLVIDSSSLLQPLLKLGWTQWIGAVIFIWGSLHQIRCHAILGTLREHKDSDEY
VIPCGDWFNRVSCPHYLAELVIYFGMLVASGGEDIPVWFLFVFVITNLSFAAVETHKWYL
QKFEDYPRSRYAIIPFVC
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
tcaattgcacatgagaacacgcaccaaatttgtagttcttctcatattcaacttctgtat
aatgctgataatctcagatcgatcttttctaatctgcagaagttcactgttccacaaaaa
tacttcatgcatttttatgtggtcggagtgctggcaacaacaattttgcttctggcaata
tggttctatgcatatatgaaaatgacaccattattgcctgagtcatcaagttattccaca
attgccagccatcttgtaggctcaaattcattctcttttggtcgtgttcactcgcgcacc
atgggacacaagtatcatgtctggcgaacagtatttgtacttctattgatggaaattcaa
gtgctgagacgactatatgagactgaacatgtgttccactacagcccttctgctcggatg
catattgtaggatatttgacgggtctattctattatgtagctgcaccattatctcttgct
agctcttgtatccctgaagcagcagagtatcttcaaggtcaagtagctgagttcatagta
aagggtcgtgcgagaatgccagatcttgtaattgattcatcatctctactacagcctctt
ctgaagttggggtggacccagtggataggtgctgttatattcatttggggttccctccat
cagatccgttgccatgcaattcttggaacgttgcgtgagcacaaagattctgatgaatat
gtaattccttgtggtgactggtttaatcgagtctcttgccctcattaccttgctgaacta
gtaatatattttggcatgttggttgctagtggtggagaagacattccagtgtggttcctg
ttcgtatttgtgatcacaaacctgtcatttgcagcagtagaaactcacaagtggtatctt
caaaagtttgaagactatcctcgctctcgctatgccatcattccatttgtatgctag

DBGET integrated database retrieval system