KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0647300-01Help
Entry
Os04t0647300-01   CDS       T02163                                 

Gene name
Os04g0647300
Definition
Similar to H0811D08.10 protein.
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Os04t0647300-01 (Os04g0647300)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os04t0647300-01 (Os04g0647300)
Transcription machinery [BR:dosa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Os04t0647300-01 (Os04g0647300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:complement(join(32936322..32937208,32935188..32935312,32933695..32934458))
AA seq 591 aa AA seqDB search
LHPPIPAPLASHSRAHRLIPHIPRPDDHPVRAAAVPAPRRVPPHHALHSASLQPAALRVT
ARSARPEIRREHSRAPPLLPLLLPHLLLVPHSTPALSLRRRLLPHQRRLQRLRLNIRRPP
DRRRRRPRRALLRGVRGSGLRSGLRPRRRPRQVLLPPPPSASASPSPSPAAPRKRRRVEY
RAWAPDPAEFALISSADPTTSASAAAPAGLRGLNNLGNTCFMNSVLQALLHAPPLRNYFL
GDRHNRYLCPRQTPMRRRSAEANDKAACLACDLDEIYSAAFSGERTPYSPAKFLYSWWQH
ASNLASYEQQDAHEFFISILDHIHENIKDDQHKSLAQGHGDCCIAHRVFSGILRSDVTCT
HCGFTSTTFEPCMDISLDLDAGYNNSLGVANPKVHVRNGERSSGGTNTKVSTLMRCLERF
TRAERLDAEQKFFCERCKERQESLKQMSIRRLPLVSCFHIKRFEHSSVKKMSRKVDHCLQ
FPFSLDMAPYLSSSILRSRFGNRIFPSEASDADSVSEFSSEFEIFAVIMHSGKLEAGHYV
TYLRLNNHWYKCDDAWVTRVEEHTVRTSQAYMLFYVQKTLYYKACERATAV
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
ctccacccccccatccccgcaccgctcgcctcccactcccgcgcccaccgcctcatcccc
cacattccccgccccgatgaccaccccgtccgcgccgccgccgtgcccgcacctcgccgc
gtaccgccacaccacgcgctccactccgcttcactccagccagctgcactccgcgtcaca
gcccgctcggcacgccccgagatccgccgcgagcactcgcgagctcccccgctgctcccc
ctgctcctcccccacctcctcctcgtcccgcactctacgcctgcactctcactgcgccgc
cgtcttctgccccaccaacgccgcctccaacgcctccgcctcaacatccggcggccacca
gatcgccgtcgacgtcgaccgcgccgagctcttctgcggggcgtgcggggatcaggtcta
cgatccggacttcgaccacgccgtcgtcctcgccaagtcctcctccctcctcccccatcg
gcatccgcttccccctccccttcccccgccgcgccccgcaagcgccgccgcgtcgagtac
cgcgcctgggcaccagatccggccgaattcgcgctcatcagctccgccgatcccaccacc
tccgcatccgccgccgcgcccgcggggctccgcgggctcaacaacctaggcaacacgtgc
ttcatgaactccgtgctccaggctctgctacacgcgccgccgctccggaactacttcctc
ggcgatcggcacaaccgctacctctgcccgcgccagacgcccatgaggcgccgttccgcc
gaggcaaacgacaaggcggcgtgcctggcgtgcgatctcgacgagatctactccgccgcc
ttttccggggagcgcacgccctacagccccgccaaattcctctatagctggtggcagcat
gcatcaaatcttgcgagctacgagcaacaggatgcacatgaattttttatctccatcctt
gaccatatccatgaaaatataaaggatgatcaacacaaatcacttgcccaaggccatgga
gattgttgcattgcacacagggtattttctggcatcttgagatcagatgtcacctgcaca
cattgtgggttcacatcaacaacttttgaaccctgtatggacatctctctagacttggat
gctggatataacaattctcttggtgttgcaaacccaaaggtacatgtgcggaatggagag
cgaagctcaggtggcactaataccaaggtatcaacactcatgagatgtttggagcggttt
acaagggctgagcggttggatgctgaacagaagttcttctgtgaacgttgcaaggagagg
caagagtccctgaagcaaatgtccattcggaggcttccattggtttcatgctttcatatt
aagaggtttgagcattcatcagttaagaaaatgtcaaggaaggttgatcactgtttacag
tttcctttttctcttgacatggcgccatatctatcgtcctctatactcagaagcagattt
gggaaccgtatatttccatcagaagctagtgatgcagattcagtttctgaattttcatca
gaatttgaaatatttgcggtgatcatgcatagtggtaagctagaagctggccattatgtg
acatatctcaggttaaacaatcactggtacaaatgtgatgatgcctgggtaaccagagtt
gaagagcatactgtcagaacctctcaggcatacatgctcttctatgtgcagaagacactt
tactacaaagcttgtgaaagagcaactgctgtctga

DBGET integrated database retrieval system