KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0647800-01Help
Entry
Os04t0647800-01   CDS       T02163                                 

Gene name
Os04g0647800
Definition
Similar to Glycerol kinase-like protein.
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dosa00561]
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:dosa04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr04:complement(join(32959517..32959647,32958123..32958344,32957054..32958047,32956106..32956348))
AA seq 529 aa AA seqDB search
MAEEVYVASIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVKIC
MAKALDKAAADGHNMDVGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICRRL
ESDLSGGRTHFVETCGLPISTYFSALKVLWLIENVDAVKNAVRAGDALFGTIDTWLIWNL
TGGIGGTDRDGNKVFGHHVTDCSNASRTMLMNLKALDWDKPTLETLGIPAEILPKIISNS
ERIGVVANGFPLAGVPIAGCLGDQHAAMLGQLCQKGEAKSTYGTGAFILLNTGEEPTQSS
HGLLSTIAYKLGPSAPTNYALEGSIAIAGAAVQWLRDSLGIISTAADIEKLADTVQDSGG
IYFVPAFNGLFAPWWRDDARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGE
AGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGV
WSKEQIFAGLHKENTRVFRPKLDEAHRRKRADSWYKAVSRSFDLADLSL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggaggtgtatgtcgcgtcgatcgaccagggcacgacgagcacgcggttcatc
gtctacgaccgccacgccaagcccgtcgcgtcgcatcagctcgagttcaagcagcactac
ccggaggctggatgggttgagcatgatcctatggagattatggagagtgtgaagatatgc
atggcgaaggcacttgacaaagctgcagctgatggtcataatatggatgttggactgaag
gccattggtattacaaatcagagggaaaccactgttatgtggagcaaatccacaggcctt
cctctatacaatgccattgtatggatggatgctcgcacaagccccatttgcaggagattg
gaaagtgatctttctggtggtagaacccactttgtcgagacatgtggattgccaatcagt
acctatttcagtgctttgaaggtgttatggttgatcgaaaatgtggatgccgtcaagaat
gcagtccgagctggtgatgccttatttggcacaattgacacctggttaatctggaacctc
acaggaggcattggcgggacagatcgtgatggaaataaagtatttgggcaccatgtcaca
gactgctccaatgcatctcgcacaatgcttatgaacctgaaggcacttgactgggacaaa
ccaacacttgagacgttaggaattcctgctgagatattgcccaaaattatcagtaactcg
gagagaattggtgtggttgccaatgggtttcccttggcgggcgtccctattgctgggtgc
ctaggagaccagcatgctgcaatgcttgggcagctgtgccagaaaggtgaagccaaaagc
acctacggaactggtgccttcattcttctcaacacaggggaggagcctacccaatcctcc
catggtcttcttagcacgattgcttataagcttggcccaagcgcacccactaattatgct
ctagaaggctccatcgcaattgctggtgccgcagttcagtggttgagagacagccttgga
atcattagcacagcagctgatattgaaaagttggctgatactgtgcaggattcaggtgga
atatactttgttccagcattcaatgggttgtttgcaccatggtggagggatgatgcaaga
ggcatatgtataggaatcacacggttcactaacaaggggcacattgctcgagcagtgctc
gagagtatgtgctttcaggtgaatgatgtcctcagctccatgcacaaggatgctggggag
gcaggagaagtgaagagtgcagaaggggagttcctgctgcgcgttgatggtggtgctact
gtcaacaatcttctcatgcagatccaggctgatttattgggtagccctgttgtcagacct
gctgacatcgagacaactgcccttggagctgcgtatgcagctggattagctgttggagtc
tggtcgaaggaacaaattttcgctggtttgcacaaggagaacaccagagtcttccgcccg
aaattggatgaggcccacaggaggaagagagcagactcctggtacaaggccgtttcaaga
tcatttgatttggctgacctttctctttag

DBGET integrated database retrieval system