KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0647800-01Help
Entry
Os04t0647800-01   CDS       T02163                                 

Gene name
Os04g0647800
Definition
Similar to Glycerol kinase-like protein.
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Os04t0647800-01 (Os04g0647800)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    Os04t0647800-01 (Os04g0647800)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Os04t0647800-01 (Os04g0647800)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Os04t0647800-01 (Os04g0647800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr04:complement(join(32959517..32959647,32958123..32958344,32957054..32958047,32956106..32956348))
AA seq 529 aa AA seqDB search
MAEEVYVASIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVKIC
MAKALDKAAADGHNMDVGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICRRL
ESDLSGGRTHFVETCGLPISTYFSALKVLWLIENVDAVKNAVRAGDALFGTIDTWLIWNL
TGGIGGTDRDGNKVFGHHVTDCSNASRTMLMNLKALDWDKPTLETLGIPAEILPKIISNS
ERIGVVANGFPLAGVPIAGCLGDQHAAMLGQLCQKGEAKSTYGTGAFILLNTGEEPTQSS
HGLLSTIAYKLGPSAPTNYALEGSIAIAGAAVQWLRDSLGIISTAADIEKLADTVQDSGG
IYFVPAFNGLFAPWWRDDARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGE
AGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGV
WSKEQIFAGLHKENTRVFRPKLDEAHRRKRADSWYKAVSRSFDLADLSL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggaggtgtatgtcgcgtcgatcgaccagggcacgacgagcacgcggttcatc
gtctacgaccgccacgccaagcccgtcgcgtcgcatcagctcgagttcaagcagcactac
ccggaggctggatgggttgagcatgatcctatggagattatggagagtgtgaagatatgc
atggcgaaggcacttgacaaagctgcagctgatggtcataatatggatgttggactgaag
gccattggtattacaaatcagagggaaaccactgttatgtggagcaaatccacaggcctt
cctctatacaatgccattgtatggatggatgctcgcacaagccccatttgcaggagattg
gaaagtgatctttctggtggtagaacccactttgtcgagacatgtggattgccaatcagt
acctatttcagtgctttgaaggtgttatggttgatcgaaaatgtggatgccgtcaagaat
gcagtccgagctggtgatgccttatttggcacaattgacacctggttaatctggaacctc
acaggaggcattggcgggacagatcgtgatggaaataaagtatttgggcaccatgtcaca
gactgctccaatgcatctcgcacaatgcttatgaacctgaaggcacttgactgggacaaa
ccaacacttgagacgttaggaattcctgctgagatattgcccaaaattatcagtaactcg
gagagaattggtgtggttgccaatgggtttcccttggcgggcgtccctattgctgggtgc
ctaggagaccagcatgctgcaatgcttgggcagctgtgccagaaaggtgaagccaaaagc
acctacggaactggtgccttcattcttctcaacacaggggaggagcctacccaatcctcc
catggtcttcttagcacgattgcttataagcttggcccaagcgcacccactaattatgct
ctagaaggctccatcgcaattgctggtgccgcagttcagtggttgagagacagccttgga
atcattagcacagcagctgatattgaaaagttggctgatactgtgcaggattcaggtgga
atatactttgttccagcattcaatgggttgtttgcaccatggtggagggatgatgcaaga
ggcatatgtataggaatcacacggttcactaacaaggggcacattgctcgagcagtgctc
gagagtatgtgctttcaggtgaatgatgtcctcagctccatgcacaaggatgctggggag
gcaggagaagtgaagagtgcagaaggggagttcctgctgcgcgttgatggtggtgctact
gtcaacaatcttctcatgcagatccaggctgatttattgggtagccctgttgtcagacct
gctgacatcgagacaactgcccttggagctgcgtatgcagctggattagctgttggagtc
tggtcgaaggaacaaattttcgctggtttgcacaaggagaacaccagagtcttccgcccg
aaattggatgaggcccacaggaggaagagagcagactcctggtacaaggccgtttcaaga
tcatttgatttggctgacctttctctttag

DBGET integrated database retrieval system