KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0653400-01Help
Entry
Os04t0653400-01   CDS       T02163                                 

Gene name
Os04g0653400
Definition
Similar to NADPH-cytochrome P450 reductase (Fragment).
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Os04t0653400-01 (Os04g0653400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(33329884..33330186,33330321..33330380,33330488..33330564,33331132..33331189,33331279..33331362,33331458..33331494,33331955..33332024,33332755..33332949,33333047..33333139,33333287..33333518,33333615..33333698,33333788..33333939,33334305..33334401,33334528..33334677,33334762..33334839,33334923..33335045,33335159..33335272,33335388..33335468)
AA seq 695 aa AA seqDB search
MALALEAARSWAASVLPPELAAAAGGDPLAALAATAAALVAGVVILAVWFRSGGGAPPKA
AAPPPRPPPVKIEADADADDGRKRVTVFFGTQTGTAEGFAKAMAEEARARYEKAVFKVVD
LDDYAAEDEEYEEKLRKETIVLLFLATYGDGEPTDNAARFYKWFTEGKEKEVWLKDLKYA
VFGLGNRQYEHFNKVAKVVDELLEEQGGKRLVPVGLGDDDQCIEDDFTAWKEQVWPELDQ
LLRDEDDTTGASTPYTAAIPEYRIVFIDKSDVSFQDKSWSLANGSGVIDIHHPVRSNVAV
RKELHKPASDRSCIHLEFDISGTGLVYETGDHVGVYSENAIETVEQAEKLLDLSPDTFFS
VHADAEDGSPRKGGGSLAPPFPSPCTLRTALLRYADLLNSPKKAALVALAAHASDLAEAE
RLRFLASPAGKDEYSQWVVASQRSLLEVMAAFPSAKPPLGVFFAAVAPRLQPRYYSISSS
PKMAPSRIHVTCALVYGPTPTGRIHQGVCSTWMKNAIPSEYSEECSWAPIYVRQSNFKLP
ADPTTPIIMIGPGTGLAPFRGFLQERLALKQSGVELGNSVLFFGCRNRNMDYIYEDELQN
FIQEGALSELIVAFSREGPAKEYVQHKMTEKATEIWNIVSQGGYIYVCGDAKGMARDVHR
ALHTIVQEQGSLDSSKTESYVKSLQMDGRYLRDVW
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggcgctggaggcggcgaggtcgtgggcggcgtccgtgctgccgccggagctc
gccgccgcggcggggggcgacccgctcgccgccctcgccgccacggccgcggcgctcgtc
gccggggtggtcatcctcgccgtgtggttccgatccggtggaggggcgccgcccaaggcc
gccgcgccgccgccgcgcccgccgccggtcaagatcgaggccgacgccgacgccgacgac
ggccggaagcgcgtcaccgtcttcttcggcacgcagaccggcaccgccgagggcttcgct
aaggcgatggcagaggaggcgagggcgcggtacgagaaggcggtgttcaaagttgtggat
ctggatgactatgcagctgaggatgaggagtacgaggagaagctcaggaaggaaactatc
gtgttgctcttcctagcaacatatggggatggggagcctaccgacaatgctgcaagattc
tacaaatggttcactgaggggaaggaaaaggaagtctggcttaaggatcttaagtatgct
gtttttggcctgggaaataggcagtatgagcactttaataaggttgcaaaggtggtggac
gaactgctagaggagcagggtggcaagcgtcttgtcccagttggccttggagatgatgat
cagtgcattgaggatgacttcacagcatggaaagaacaagtttggccagaattggaccaa
ctgctccgtgatgaagatgatacaactggtgcatccactccttacactgctgctatacct
gaatacagaattgtatttattgataaatcagatgtatcgttccaagacaaatcgtggtca
cttgccaatggcagtggtgttattgatattcaccatcctgtcaggtctaatgttgctgtt
cgaaaggaactccataagccagcttcagatcgctcttgcattcatctggagttcgatatc
tcaggcactggtcttgtgtatgaaactggtgaccatgttggtgtttattcagaaaatgct
atcgagacagtggagcaggctgaaaagctgctagatctttccccagatacatttttctcc
gtccatgcagacgcagaagatggatcacctcgtaaagggggtggttctttggccccacct
ttcccttctccttgcaccttacggactgcacttctaagatatgctgatctacttaattct
ccaaagaaggctgctttggttgctttagctgctcatgcgtctgacctagctgaagctgaa
agattgagatttttggcttcccctgctggaaaggatgaatattctcaatgggtagtagct
agccaaagaagccttcttgaagttatggctgcattcccttcagctaagcccccactggga
gtattctttgcagctgttgcacctcgcctacaaccgcgttactactccatatcatcatct
ccaaagatggctccttccagaattcatgtaacatgtgcgttagtttatggacctacacca
acgggaaggattcaccaaggagtttgttcgacatggatgaagaacgcaatcccatcagaa
tatagtgaagagtgtagctgggcaccaatttatgtgaggcagtcaaattttaagttgcct
gcagatccgaccactccaattatcatgattggtcctggtacagggttagcaccatttaga
ggcttcttgcaggaaagattagctctaaaacaatctggagttgaactgggcaattcagtt
ctcttctttggatgcaggaaccgtaatatggactacatatatgaagacgagttgcaaaac
ttcattcaggagggtgcactttctgagctgattgttgccttctctcgtgaaggaccagcc
aaagaatacgtgcagcataagatgacagagaaggccacagaaatttggaacatcgtctca
caaggtggttacatatatgtgtgcggtgatgccaagggtatggcaagagacgtacacaga
gctcttcatacaattgttcaagagcagggatctttggatagctccaaaaccgagagctat
gtaaagagcctacagatggacggcaggtacctccgtgacgtatggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system