KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0664800-00Help
Entry
Os04t0664800-00   CDS       T02163                                 

Gene name
Os04g0664800
Definition
(RAP-DB) Similar to Cell wall invertase (EC 3.2.1.26).
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Os04t0664800-00 (Os04g0664800)
   00500 Starch and sucrose metabolism
    Os04t0664800-00 (Os04g0664800)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Os04t0664800-00 (Os04g0664800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:complement(join(33943208..33943361,33943054..33943062,33942049..33942941,33941545..33941948,33941315..33941408,33940998..33941234))
AA seq 596 aa AA seqDB search
MALAGLPLSVFAIAVHFCLVFSSSSSPPVCPANGHRDRTAYHFQPAKNWQNDPNGPVYYN
GMYHLFYQYNPHGALWDVGNLSWGHSVSGDLVNWAALDNALDPTAPFDANGCASGSVTIL
PDGVPVVMYSGIDARRRQVQNVAFPKNPRDPLLREWTKPGYNPVIPVPADVSPDNFRDPT
TAWLGSDGLWRFAISAVADGVGATLVYRSADFLRWERNAAPLHASRDAVMAECPDLFPVA
EHGEDGLDLDASAIGGAGAGVRHVLKVSMPDTLEDYYMVGRYDDADDTFTVPPEDLEAHG
DDYRRWRRIDHGHLYASKTFYDAGKKRRVLWAWVNESDSEADDVTKGWSGLQSFPRAVWL
DEGGRQLVQWPVEEIETLRRKRGVLLGGNEVEAGGLREIGGIAGSQADVEVAFEIASLAG
ADRLEPDHLRDPDALCGENGAAVHGGIGPFGLLVMASGDLRERTAVFFRVFRLSHGYTVL
MCTDLTRSTSRAGVYKPSHGGFVDIDIEKDRAISLRTLIDHSIVESFGGGGRTCMTARVY
PEHVATGSSHLYVFNNASDAVKVSKLEAWELATASVNAGDDGLISYGGPVCAAQVQ
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcgttggctggattgcccctctccgtctttgccatcgctgtccatttttgccttgtt
ttctcctcctcctcttctcctccggtttgccctgcaaacggccaccgtgaccgaacggcg
taccacttccaacccgccaagaactggcagaacgatccgaatgggcctgtgtactacaat
ggcatgtaccacctcttctaccagtacaacccgcacggcgcgctctgggacgtcggcaac
ctctcctgggggcactccgtctccggcgacctcgtgaactgggccgccctcgacaacgcg
ctcgatcccacagcgccattcgacgccaatggttgcgcgtcggggtcagtcaccatcctc
cccgacggcgtgcccgtcgtcatgtactccggcatcgacgcccgccgccggcaggtccag
aacgtcgcgttccccaagaaccctcgcgacccgctcctccgcgagtggaccaagcccggg
tacaacccggtcatccctgtccccgccgacgtctcgccggacaatttccgggaccccacc
accgcctggctcggcagcgacggcctgtggcggttcgccatctccgccgtggccgacggc
gtgggcgcgacgctcgtgtaccggagcgccgacttcctgcggtgggagcgcaacgcggcg
ccgctgcacgcctcgcgggacgcggtcatggccgagtgccccgacctgttccccgtcgcc
gagcacggcgaggacgggctcgacctcgacgcgtcggcgatcggcggcgccggcgccggc
gtgaggcacgtcctcaaggtcagcatgccggacaccctcgaggactactacatggtcgga
cggtacgacgacgcggacgacacgttcaccgtgccgccggaggacctggaagcccacggc
gatgactaccggcggtggcggcggatcgaccacggccacctgtacgcgtccaagacgttc
tacgacgcgggcaagaaacggcgcgtgctgtgggcgtgggtgaacgagtccgacagcgag
gccgacgacgtcaccaagggctggtccggccttcagtcgtttccgcgggcggtgtggctg
gacgagggcgggaggcagctggtgcagtggccggtggaggagatcgagacgctgaggcgg
aaacgcggcgttctgctcggcggaaacgaggtggaggcgggcgggctgcgcgagatcggc
ggcatcgcgggctcgcaggcggacgtggaggtagcgttcgagatcgcgagcctcgcgggc
gccgaccgcctcgagcccgaccatttgcgtgaccccgacgcgctgtgcggggagaatggc
gcggcggtgcacggcggaatcggcccgttcgggctgctcgtcatggcatccggcgacctg
cgcgagcgcaccgccgttttcttcagggtgttcaggctctcgcacgggtacacggtcctc
atgtgcacggacctgacacggtcaacttcaagagcaggggtgtacaagccatcccacgga
ggattcgtggacatagacatagagaaggacagggctatatcgcttcgaaccctgatcgat
cattcgatcgtggagagttttggcggtggggggcggacgtgcatgacggctcgagtgtac
cctgaacatgtagcaacggggagcagccacctgtacgtgttcaacaatgcgtcagatgcg
gtgaaggtgtccaagctggaggcatgggagctcgcgacggctagtgtcaatgctggagac
gacgggctgatttcgtatggtggtcctgtatgtgctgctcaagtgcagtaa

DBGET integrated database retrieval system